@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu03270: (2016-06-05 )
MAENQEVYDVTIIGGGPIGLFTAFYCGMRELKTKVIEFLPKLGGKVSLFFPEKIIRDIGGIPGIAGKQLIEQLKEQAATFDPDIVLNQRVTGFERLDDGTIVLTGSEGKKHYTRTVILACGMGTLEVNEFDSEDAARYAGKNLHYGVEKLDAFKGKRVVISGGGDTAVDWANELEPIAASVTVVHRREEFGGMESSVTKMKQSSVRVLTPYRLEQLNGDEEGIKSVTVCHTESGQRKDIEIDELIINHGFKIDLGPMMEWGLEIEEGRVKADRHMRTNLPGVFVAGDAAFYESKLRLIAGGFTEGPTAVNSAKAYLDPKAENMAMYSTHHKKLVHK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FAD_B_6(3LZX)
FENR2_BACSU
[Raw transfer]




FAD_A_3(3LZX)
FENR2_BACSU
[Raw transfer]




FAD_A_2(3LZW)
FENR2_BACSU
[Raw transfer]




FAD_A_2(3LZW)
FENR2_BACSU
[Raw transfer]




FAD_A_3(3AB1)
FENR_CHLTE
[Raw transfer]




FAD_A_3(3AB1)
FENR_CHLTE
[Raw transfer]




FAD_B_4(3AB1)
FENR_CHLTE
[Raw transfer]




21 PsiBlast_CBE 91.1748%-113 - C1 -3LZX 12.8 FENR2_BACSU
24 HHSearch 88.6849%-114 - C1 -3LZW 12.8 FENR2_BACSU
1 PsiBlast_PDB 88.6448%-113 - C1 -3LZW 12.8 FENR2_BACSU
2 PsiBlast_PDB 88.2948%-112 - C1 -3LZX 12.6 FENR2_BACSU
3 PsiBlast_PDB 80.6837%-109 - C1 -3AB1 11.0 FENR_CHLTE
25 HHSearch 80.0237%-114 - C1 -3AB1 11.1 FENR_CHLTE
22 PsiBlast_CBE 78.9037%-104 - C1 -3AB1 12.3 FENR_CHLTE
4 PsiBlast_PDB 77.6237%-122 - C1 -2ZBW - FENR_THET8 -
26 HHSearch 77.3837%-115 - C1 -2ZBW - FENR_THET8 -
27 HHSearch 71.0927%-116 - C1 -3F8D - ? -
35 HHSearch 69.6626%-123 - C1 -2Q0L - TRXB_HELPY -
6 PsiBlast_PDB 68.6427%-113 - C1 -2Q0L - TRXB_HELPY -
9 PsiBlast_PDB 68.1927%-111 - C1 -3F8P - ? -
7 PsiBlast_PDB 67.5727%-112 - C1 -3ISH - TRXB_HELPY -
40 HHSearch 67.5125%-116 * C1 *3R9U - ? -
5 PsiBlast_PDB 67.3727%-114 - C1 -2Q0K - TRXB_HELPY -
41 HHSearch 67.1625%-117 - C1 -4JNQ - ? -
28 HHSearch 67.0327%-105 - C1 -4GCM - TRXB_STAAW -
8 PsiBlast_PDB 66.9127%-112 - C1 -3F8D - ? -
32 HHSearch 65.3824%-104 - C1 -1FL2 - AHPF_ECOLI -