@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu03630: (2016-06-06 )
MKAEFKRKGGGKVKLVVGMTGATGAIFGVRLLQWLKAAGVETHLVVSPWANVTIKHETGYTLQEVEQLATYTYSHKDQAAAISSGSFDTDGMIVAPCSMKSLASIRTGMADNLLTRAADVMLKERKKLVLLTRETPLNQIHLENMLALTKMGTIILPPMPAFYNRPRSLEEMVDHIVFRTLDQFGIRLPEAKRWNGIEKQKGGA

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FMN_A_5(1SBZ)
PADL_ECO57
[Raw transfer]




FMN_A_5(1SBZ)
PADL_ECO57
[Raw transfer]




36 HHSearch 90.1760%-153 - C2 -1SBZ 6.8 PADL_ECO57
1 PsiBlast_PDB 87.7256%-156 - C2 -1SBZ 6.8 PADL_ECO57
7 PsiBlast_PDB 80.8638%-154 - C2 -4ZAG - UBIX_PSEAE -
3 PsiBlast_PDB 79.3739%-153 - C2 -4ZAF - UBIX_PSEAE -
8 PsiBlast_PDB 79.3438%-150 - C2 -4ZAL - UBIX_PSEAE -
4 PsiBlast_PDB 78.8439%-147 - C2 -4ZAV - UBIX_PSEAE -
2 PsiBlast_PDB 78.7339%-150 - C2 -3ZQU - UBIX_PSEAE -
9 PsiBlast_PDB 78.6838%-146 - C2 -4ZAY - UBIX_PSEAE -
5 PsiBlast_PDB 78.4839%-148 - C2 -4ZAW - UBIX_PSEAE -
11 PsiBlast_PDB 78.3938%-151 - C2 -4ZAZ - UBIX_PSEAE -
6 PsiBlast_PDB 78.2139%-149 - C2 -4ZAX - UBIX_PSEAE -
10 PsiBlast_PDB 77.9438%-152 - C2 -4ZAN - UBIX_PSEAE -
14 PsiBlast_PDB 77.8835%-179 - C2 -4RHE - ? -
21 PsiBlast_CBE 77.4635%-180 - C2 -4RHE - ? -
13 PsiBlast_PDB 77.3735%-179 - C2 -4RHF - ? -
39 HHSearch 77.3639%-138 - C2 -4ZAV - UBIX_PSEAE -
38 HHSearch 77.1833%-167 - C2 -4RHF - ? -
25 PsiBlast_CBE 76.7835%-180 - C2 -4RHE - ? -
22 PsiBlast_CBE 76.5435%-177 - C2 -4RHE - ? -
24 PsiBlast_CBE 76.4535%-178 - C2 -4RHE - ? -