@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu03730: (2016-06-06 )
MSLLQFQQVGYWYKNKSQPLFQDINISFQKGKFYTIVGTSGTGKTTFLSLAGGLDAPKEGNILYDGKAVSKIGLTNFRNQYVSIVFQAYNLLPYMTALQNVTTAMEITGSKEKNKESYALDMLQKVGINEKQARQKVLTLSGGQQQRVSITRAFCCDTDLIVADEPTGNLDEDTSKEIVRLFQDLAHKEDKCVIMVTHDEQIAKVSDINIRLSRGSFTVKENVAVV

Atome Classification :

(45 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ANP_J_5(3C41)
?
[Raw transfer]




ATP_J_5(4YMU)
?
[Raw transfer]




ATP_J_5(4YMV)
?
[Raw transfer]




ANP_K_6(3C41)
?
[Raw transfer]




ATP_A_7(4YMU)
?
[Raw transfer]




AGS_B_6(3C4J)
?
[Raw transfer]




ATP_A_6(4YMV)
?
[Raw transfer]




AGS_A_4(3C4J)
?
[Raw transfer]




ADP_C_11(4HLU)
ECFA1_THEMA
[Raw transfer]




ADP_A_2(4U00)
?
[Raw transfer]




ADP_B_6(2Q0H)
?
[Raw transfer]




ADP_A_5(2Q0H)
?
[Raw transfer]




ADP_D_7(4HLU)
ECFA1_THEMA
[Raw transfer]




AT4_B_6(2OLK)
?
[Raw transfer]




AT4_D_8(2OLK)
?
[Raw transfer]




ADP_B_6(2OLJ)
?
[Raw transfer]




ADP_A_5(2OLJ)
?
[Raw transfer]




AT4_A_5(2OLK)
?
[Raw transfer]




ATP_C_3(1VCI)
?
[Raw transfer]




AT4_C_7(2OLK)
?
[Raw transfer]




ANP_A_6(3B5Y)
MSBA_SALTY
[Raw transfer]




ANP_B_5(3B5Y)
MSBA_SALTY
[Raw transfer]




ANP_D_7(3B5Y)
MSBA_SALTY
[Raw transfer]




ATP_A_5(1B0U)
HISP_SALTY
[Raw transfer]




ANP_C_8(3B5Y)
MSBA_SALTY
[Raw transfer]




ADP_C_7(3B5Z)
MSBA_SALTY
[Raw transfer]




ADP_A_5(3B5Z)
MSBA_SALTY
[Raw transfer]




ADP_D_8(3B5Z)
MSBA_SALTY
[Raw transfer]




ADP_B_6(3B5Z)
MSBA_SALTY
[Raw transfer]




4 PsiBlast_PDB 84.0134% -97 - C1 -1F3O - Y796_METJA -
22 PsiBlast_CBE 82.4133%-104 - C1 -1L2T - Y796_METJA -
23 PsiBlast_CBE 80.3832%-108 - C1 -3TIF - Y796_METJA -
27 PsiBlast_CBE 76.9534%-122 - C1 -4U02 - ? -
3 PsiBlast_PDB 75.5133% -97 - C1 -1L2T - Y796_METJA -
28 PsiBlast_CBE 75.0334%-115 - C1 -4U02 - ? -
26 PsiBlast_CBE 74.6934%-113 - C1 -4U02 - ? -
11 PsiBlast_PDB 73.8734%-117 - C1 -4U00 6.3 ?
5 PsiBlast_PDB 73.8532%-101 - C1 -3TIF - Y796_METJA -
82 Fugue 73.2726%-115 - C1 -1Z47 - ? -
84 Fugue 72.8924%-135 - C1 -3TUZ - METN_ECOLI -
12 PsiBlast_PDB 72.4634%-109 - C1 -4U02 - ? -
80 Fugue 71.4125%-121 - C1 -1OXS - ? -
9 PsiBlast_PDB 71.2935%-115 - C1 -4YMV 4.8 ?
24 PsiBlast_CBE 71.0735%-112 - C1 -4YMV 4.0 ?
77 HHSearch 70.9925%-130 - C1 -4MRS - ATM1_NOVAD -
25 PsiBlast_CBE 70.9635%-116 - C1 -4YMU 5.5 ?
6 PsiBlast_PDB 70.8635%-115 - C1 -4YMS - ? -
69 HHSearch 70.5024%-132 - C1 -3TUI - METN_ECOLI -
7 PsiBlast_PDB 69.9335%-114 - C1 -4YMT - ? -
8 PsiBlast_PDB 67.3735%-110 - C1 -4YMU 4.9 ?
54 PsiBlast_CBE 64.4932%-139 - C1 -4HLU 4.9 ECFA1_THEMA
38 PsiBlast_CBE 64.1833%-113 - C1 -3C41 5.9 ?
13 PsiBlast_PDB 63.9333%-124 - C1 -2OLJ 4.8 ?
34 PsiBlast_CBE 63.1833%-117 - C1 -2OLK 4.9 ?
55 PsiBlast_CBE 61.8432%-138 - C1 -4HLU 5.5 ECFA1_THEMA
17 PsiBlast_PDB 60.6833%-115 - C1 -3C4J 4.7 ?
14 PsiBlast_PDB 60.3933%-119 - C1 -2OLK 4.5 ?
29 PsiBlast_CBE 60.3633%-116 - C1 -3C4J 4.8 ?
36 PsiBlast_CBE 59.9733%-117 - C1 -2OLK 4.7 ?
16 PsiBlast_PDB 59.3633%-117 - C1 -2Q0H 3.7 ?
35 PsiBlast_CBE 59.0233%-119 - C1 -2OLK 4.4 ?
37 PsiBlast_CBE 57.3933%-112 - C1 -2OLJ 4.7 ?
39 PsiBlast_CBE 57.1637%-112 - C1 -1B0U 3.7 HISP_SALTY
30 PsiBlast_CBE 56.5433%-119 - C1 -2Q0H 4.8 ?
18 PsiBlast_PDB 55.4933%-103 - C1 -3C41 4.8 ?
53 PsiBlast_CBE 43.8432% - - C1 -3B5Y 2.1 MSBA_SALTY
52 PsiBlast_CBE 43.8232% - - C1 -3B5Y 1.9 MSBA_SALTY
51 PsiBlast_CBE 43.8132% - - C1 -3B5Y 1.9 MSBA_SALTY
50 PsiBlast_CBE 43.8132% - - C1 -3B5Y 1.9 MSBA_SALTY
49 PsiBlast_CBE 43.5332% - - C1 -3B5Z 2.3 MSBA_SALTY
46 PsiBlast_CBE 43.5332% - - C1 -3B5Z 2.5 MSBA_SALTY
48 PsiBlast_CBE 43.5232% - - C1 -3B5Z 2.9 MSBA_SALTY
47 PsiBlast_CBE 43.5032% - - C1 -3B5Z 2.3 MSBA_SALTY
40 PsiBlast_CBE 41.4933%-128 - C1 -1VCI 3.4 ?