@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu03820: (2016-06-06 )
MVEVRNVSKQYGGKVVLEETSVTIQKGKITSFIGPNGAGKSTLLSIMSRLIKKDSGEIYIDGQEIGACDSKELAKKMSILKQANQINIRLTIKDLVSFGRFPYSQGRLTEEDWVHINQALSYMKLEDIQDKYLDQLSGGQCQRAFIAMVIAQDTDYIFLDEPLNNLDMKHSVEIMKLLKRLVEELGKTIVIVIHDINFASVYSDYIVALKNGRIVKEGPPEEMIETSVLEEIYDMTIPIQTIDNQRIGVYFS

Atome Classification :

(25 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_J_5(4YMU)
?
[Raw transfer]




ATP_A_7(4YMU)
?
[Raw transfer]




ANP_J_5(3C41)
?
[Raw transfer]




ATP_A_5(1B0U)
HISP_SALTY
[Raw transfer]




ATP_J_5(4YMV)
?
[Raw transfer]




ATP_A_3(3FVQ)
FBPC_NEIG1
[Raw transfer]




AGS_A_4(3C4J)
?
[Raw transfer]




ADP_C_11(4HLU)
ECFA1_THEMA
[Raw transfer]




ADP_A_3(1F3O)
Y796_METJA
[Raw transfer]




ATP_A_6(4YMV)
?
[Raw transfer]




ADP_A_3(3TIF)
Y796_METJA
[Raw transfer]




ADP_A_5(2OLJ)
?
[Raw transfer]




ADP_A_5(2Q0H)
?
[Raw transfer]




ADP_B_8(3TIF)
Y796_METJA
[Raw transfer]




AT4_A_5(2OLK)
?
[Raw transfer]




1 PsiBlast_PDB 74.5128%-156 - C1 -4G1U - HMUV_YERPE -
24 PsiBlast_CBE 70.8432%-138 - C1 -4YMU 5.9 ?
21 PsiBlast_CBE 70.3434%-123 - C1 -1L2T - Y796_METJA -
50 Fugue 70.2027%-125 - C1 -1Z47 - ? -
36 HHSearch 69.8031%-138 - C1 -3RLF - MALK_ECOLI -
25 PsiBlast_CBE 69.6232%-135 - C1 -3GFO - ECFA3_CLOP1 -
6 PsiBlast_PDB 68.7132%-131 - C1 -4YMU 5.8 ?
22 PsiBlast_CBE 68.6435%-121 - C1 -3TIF 6.1 Y796_METJA
5 PsiBlast_PDB 68.5332%-131 - C1 -4YMT - ? -
4 PsiBlast_PDB 67.3732%-132 - C1 -4YMS - ? -
3 PsiBlast_PDB 67.2935%-117 - C1 -3TIF 6.0 Y796_METJA
26 PsiBlast_CBE 67.1133%-150 - C1 -4HLU 5.9 ECFA1_THEMA
13 PsiBlast_PDB 66.6430%-136 - C1 -2OLK 6.3 ?
8 PsiBlast_PDB 66.1832%-131 - C1 -4YMW - ? -
12 PsiBlast_PDB 66.0730%-136 - C1 -2OLJ 6.5 ?
7 PsiBlast_PDB 64.7732%-134 - C1 -4YMV 5.0 ?
23 PsiBlast_CBE 64.5832%-132 - C1 -4YMV 5.0 ?
27 PsiBlast_CBE 64.3332%-120 - C1 -1B0U 5.9 HISP_SALTY
30 HHSearch 64.2528%-128 - C1 -1Z47 - ? -
14 PsiBlast_PDB 63.5630%-133 - C1 -2OUK - ? -
16 PsiBlast_PDB 62.7430%-132 - C1 -3C4J 6.7 ?
9 PsiBlast_PDB 61.3934%-118 - C1 -1F3O 5.7 Y796_METJA
11 PsiBlast_PDB 60.2230%-126 - C1 -3C41 6.6 ?
15 PsiBlast_PDB 57.3330%-131 - C1 -2Q0H 5.8 ?
34 HHSearch 52.6230%-122 - C1 -3FVQ 7.0 FBPC_NEIG1