@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu04570: (2016-06-07 )
MIKRTVKNIAEMVKGTLANPQYEQTVIHGVATDTRKLEQHQLFIPLKGERFDGHSFVEQAFEAGVAAVLWDRSVPNPPENHAVILVDDTLTALQQLAKAYLQELGTRVIGVTGSNGKTTTKDMIHAVLGTQYRVHKTGGNFNNHIGLPLTVLAMPENTEIAVLEMGMSAKGEIDLLSRLANPDAAVITNIGESHMQDLGSREGIAEAKLEIINGLKEDGVLIYIGDEPLLQNAYSCQTKTYGTGTHNDYQLQDVSQSEEGTHFTIKGIENTFFIPILGKHNVMNAMAAIAAGAYFGIAPEDAAKGLSGLKVTGMRLELIKTDSGLSIINDAYNASPTSMKAAIQLTESLEGYGKKMLVLGDMLELGDLEETFHKECGAVISPDKIDRVFTYGKLGAFIAEGALKHFEKDRVSHYTEKKDLLQAVKENASKGDLILFKASRGMKLEEIVKDLIESPLS

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

2GN_A_2(3ZM6)
?
[Raw transfer]




2GN_A_2(3ZM6)
?
[Raw transfer]




IGM_A_2(3ZM5)
?
[Raw transfer]




1LG_A_2(2AM1)
?
[Raw transfer]




ANP_A_6(4CVM)
?
[Raw transfer]




2LG_A_2(2AM2)
?
[Raw transfer]




ALA_A_2(4CVM)
?
[Raw transfer]




API_A_6(4CVK)
?
[Raw transfer]




ATP_A_2(4QDI)
?
[Raw transfer]




ALA_A_2(4CVK)
?
[Raw transfer]




UDP_A_3(4QDI)
?
[Raw transfer]




MUB_A_4(4CVK)
?
[Raw transfer]




MUB_A_4(4CVK)
?
[Raw transfer]




2 PsiBlast_PDB 94.7938%-108 - C1 -3ZM6 8.3 ?
1 PsiBlast_PDB 94.5838%-110 - C1 -3ZM5 7.2 ?
36 HHSearch 94.5439%-108 - C1 -3ZM6 8.2 ?
4 PsiBlast_PDB 93.4437%-108 - C1 -2AM2 6.0 ?
3 PsiBlast_PDB 92.9737%-105 - C1 -2AM1 6.2 ?
33 HHSearch 91.4133%-124 - C1 -4CVK 2.1 ?
10 PsiBlast_PDB 89.7134%-111 - C1 -4CVM 6.5 ?
34 HHSearch 89.2433%-107 - C1 -4QDI 9.1 ?
8 PsiBlast_PDB 88.7633%-112 - C1 -1GG4 - MURF_ECOLI -
9 PsiBlast_PDB 88.4034%-115 - C1 -4CVK 2.8 ?
6 PsiBlast_PDB 86.9533%-100 - C1 -4QDI 2.6 ?
5 PsiBlast_PDB 85.9633%-105 - C1 -4ZIY - ? -
37 HHSearch 83.1731%-105 - C1 -3ZL8 - ? -
7 PsiBlast_PDB 80.8132% -97 - C1 -3ZL8 - ? -
40 HHSearch 78.2525%-115 - C1 -4BUB - MURE_THEMA -
11 PsiBlast_PDB 70.6225%-115 - C1 -4BUB - MURE_THEMA -
17 PsiBlast_PDB 63.4226%-104 - C1 -1E0D - MURD_ECOLI -
49 HHSearch 63.1121% -89 - C1 -1P3D - MURC_HAEIN -
42 HHSearch 61.9525% -88 - C1 -3LK7 - MURD_STRA5 -
48 HHSearch 61.6020% -97 - C1 -4HV4 - MURC_YERPE -