@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu04640: (2016-06-07 )
MSTKPFYRDTWAEIDLSAIKENVSNMKKHIGEHVHLMAVVKANAYGHGDAETAKAALDAGASCLAVAILDEAISLRKKGLKAPILVLGAVPPEYVAIAAEYDVTLTGYSVEWLQEAARHTKKGSLHFHLKVDTGMNRLGVKTEEEVQNVMAILDRNPRLKCKGVFTHFATADEKERGYFLMQFERFKELIAPLPLKNLMVHCANSAAGLRLKKGFFNAVRFGIGMYGLRPSADMSDEIPFQLRPAFTLHSTLSHVKLIRKGESVSYGAEYTAEKDTWIGTVPVGYADGWLRKLKGTDILVKGKRLKIAGRICMDQFMVELDQEYPPGTKVTLIGRQGDEYISMDEIAGRLETINYEVACTISSRVPRMFLENGSIMEVRNPLLQVNISN

Atome Classification :

(31 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

BME_A_5(3OO2)
ALR1_STAAC
[Raw transfer]




DCS_C_6(3E6E)
?
[Raw transfer]




IN5_B_4(1BD0)
ALR_GEOSE
[Raw transfer]




DCS_A_4(3E6E)
?
[Raw transfer]




DCS_B_5(3E6E)
?
[Raw transfer]




IN5_A_3(1BD0)
ALR_GEOSE
[Raw transfer]




IN5_A_3(1BD0)
ALR_GEOSE
[Raw transfer]




PLP_B_7(3E5P)
?
[Raw transfer]




PLP_C_10(3E5P)
?
[Raw transfer]




PLP_A_5(1SFT)
ALR_GEOSE
[Raw transfer]




PLP_B_6(1SFT)
ALR_GEOSE
[Raw transfer]




DCS_A_3(4LUT)
?
[Raw transfer]




PLP_A_3(4A3Q)
ALR1_STAAM
[Raw transfer]




PLP_A_3(4A3Q)
ALR1_STAAM
[Raw transfer]




PLP_A_3(1XFC)
ALR_MYCTU
[Raw transfer]




PLP_A_4(3E5P)
?
[Raw transfer]




PLP_B_4(1XFC)
ALR_MYCTU
[Raw transfer]




PLP_B_11(4A3Q)
ALR1_STAAM
[Raw transfer]




PLP_A_3(3CO8)
LYSR_OENOB
[Raw transfer]




PLP_A_3(3CO8)
LYSR_OENOB
[Raw transfer]




GOL_B_18(4DYJ)
ALR_PSEPU
[Raw transfer]




ALA_B_6(4Y2W)
ALR1_CALS4
[Raw transfer]




ALA_B_6(4Y2W)
ALR1_CALS4
[Raw transfer]




ALA_A_4(4Y2W)
ALR1_CALS4
[Raw transfer]




2PE_C_9(3E5P)
?
[Raw transfer]




5 PsiBlast_PDB 91.9450%-136 - C1 -3HA1 - ? -
1 PsiBlast_PDB 89.6556%-131 - C1 -1SFT 4.2 ALR_GEOSE
21 PsiBlast_CBE 89.3456%-126 - C1 -1SFT 5.7 ALR_GEOSE
2 PsiBlast_PDB 88.4456%-128 - C1 -1BD0 - ALR_GEOSE -
22 PsiBlast_CBE 87.6856%-127 - C1 -1BD0 7.7 ALR_GEOSE
48 HHSearch 86.3754%-131 - C1 -1BD0 - ALR_GEOSE -
4 PsiBlast_PDB 86.1951%-138 - C1 -3UW6 - ALR_GEOSE -
3 PsiBlast_PDB 86.0253%-143 - C1 -4ILS - ALR_GEOSE -
26 PsiBlast_CBE 80.9245%-122 - C1 -3E5P 3.6 ?
25 PsiBlast_CBE 80.8545%-123 - C1 -3E5P 3.1 ?
24 PsiBlast_CBE 80.6145%-122 - C1 -3E6E 5.3 ?
23 PsiBlast_CBE 80.2645%-124 - C1 -3E6E 5.6 ?
6 PsiBlast_PDB 79.5745%-122 - C1 -3E5P 4.1 ?
53 HHSearch 79.3946%-123 * C1 *3E5P 1.9 ?
7 PsiBlast_PDB 78.7045%-118 - C1 -3E6E 6.0 ?
14 PsiBlast_PDB 77.8236%-131 - C1 -4Y2W 3.3 ALR1_CALS4
8 PsiBlast_PDB 77.4640%-127 - C1 -3OO2 - ALR1_STAAC -
31 PsiBlast_CBE 77.1036%-130 - C1 -4Y2W 3.2 ALR1_CALS4
12 PsiBlast_PDB 77.0738%-127 - C1 -4LUY - ? -
54 HHSearch 75.1036%-129 - C1 -4Y2W 3.3 ALR1_CALS4
60 HHSearch 74.6740%-136 - C1 -4A3Q 3.8 ALR1_STAAM
10 PsiBlast_PDB 71.4938%-125 - C1 -4LUT 5.1 ?
28 PsiBlast_CBE 70.6940%-127 - C1 -4A3Q 3.7 ALR1_STAAM
9 PsiBlast_PDB 70.2840%-127 - C1 -4A3Q 3.8 ALR1_STAAM
27 PsiBlast_CBE 69.7740%-125 - C1 -3OO2 Error ALR1_STAAC
32 PsiBlast_CBE 66.4535%-123 - C1 -1XFC 3.5 ALR_MYCTU
50 HHSearch 65.8337%-118 - C1 -3CO8 4.3 LYSR_OENOB
15 PsiBlast_PDB 65.3835%-117 - C1 -3CO8 3.2 LYSR_OENOB
16 PsiBlast_PDB 64.7635%-120 - C1 -1XFC 3.7 ALR_MYCTU
42 Fugue 62.3253%-147 - C1 -1BD0 7.0 ALR_GEOSE
40 Fugue 62.0551%-138 - C1 -1BD0 7.0 ALR_GEOSE