@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu04660: (2016-06-07 )
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQIRTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CHAIN_C_3(4MDX)
ENDOA_BACSU
[Raw transfer]

-

21 PsiBlast_CBE 94.67100%-139 - C1 -4MDX - ENDOA_BACSU -
4 PsiBlast_PDB 93.1593%-150 - C1 -4HKE - ? -
87 HHSearch 92.72100%-141 - C1 -4MDX 4.7 ENDOA_BACSU
1 PsiBlast_PDB 92.72100%-141 - C1 -4MDX - ENDOA_BACSU -
2 PsiBlast_PDB 92.0699%-139 - C1 -1NE8 - ENDOA_BACSU -
22 PsiBlast_CBE 89.8493%-147 - C1 -4HKE - ? -
3 PsiBlast_PDB 87.2098%-153 - C1 -4ME7 - ENDOA_BACSU -
6 PsiBlast_PDB 87.0468%-144 - C1 -4MZP - MAZF_STAAN -
7 PsiBlast_PDB 84.9368%-134 - C1 -4MZT - MAZF_STAAN -
5 PsiBlast_PDB 84.2067%-128 - C1 -4OF1 - MAZF_STAAM -
8 PsiBlast_PDB 83.7968%-138 - C1 -4MZM - MAZF_STAAN -
9 PsiBlast_PDB 83.6968%-132 - C1 -2MF2 - MAZF_STAAN -
88 HHSearch 82.7667%-135 * C1 *4MZM - MAZF_STAAN -
77 Fugue 65.6028%-122 - C1 -1M1F - PEMK_ECOLX -
90 HHSearch 63.5328%-128 - C1 -1M1F - PEMK_ECOLX -
10 PsiBlast_PDB 60.8129%-126 - C1 -1M1F - PEMK_ECOLX -
89 HHSearch 57.5126%-150 - C- -1UB4 - MAZF_ECOLI -
18 PsiBlast_PDB 54.6730%-176 - C1 -5CKD - ? -
16 PsiBlast_PDB 54.2532%-140 - C1 -5CR2 - ? -
92 HHSearch 51.998%-190 - C1 -3VUB - CCDB_ECOLI -