@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu05120: (2016-06-08 )
MEQGTVKWFNAEKGFGFIERENGDDVFVHFSAIQSDGFKSLDEGQKVSFDVEQGARGAQAANVQKA

Atome Classification :

(27 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CHAIN_R_3(3PF4)
CSPB_BACSU
[Raw transfer]

-

TRS_A_7(1C9O)
CSPB_BACCL
[Raw transfer]




TRS_B_6(1C9O)
CSPB_BACCL
[Raw transfer]




TRS_A_7(1C9O)
CSPB_BACCL
[Raw transfer]




CHAIN_S_4(3PF5)
CSPB_BACSU
[Raw transfer]

-

NACID_U_3(3TS2)
LN28A_MOUSE
[Raw transfer]

-

NACID_B_1(2ES2)
CSPB_BACSU
[Raw transfer]

-

CHAIN_R_3(3PF4)
CSPB_BACSU
[Raw transfer]

-

CHAIN_R_3(3PF5)
CSPB_BACSU
[Raw transfer]

-

72 HHSearch 82.3691% -79 - C5 -2LXJ - CSPA_LISMO -
1 PsiBlast_PDB 82.1090% -79 - C5 -2LXJ - CSPA_LISMO -
14 PsiBlast_PDB 80.3670%-101 - C5 -1CSQ - CSPB_BACSU -
29 PsiBlast_CBE 79.2741%-170 - C5 -4A76 - ? -
13 PsiBlast_PDB 79.2570% -96 - C5 -1CSP - CSPB_BACSU -
71 HHSearch 79.1968%-109 - C5 -1C9O 2.1 CSPB_BACCL
10 PsiBlast_PDB 78.8369%-104 - C5 -1HZC - CSPB_BACCL -
38 PsiBlast_CBE 78.5841%-155 - C5 -3ULJ - ? -
9 PsiBlast_PDB 78.4570%-111 - C5 -2I5M - CSPB_BACSU -
4 PsiBlast_PDB 78.3669%-106 - C5 -1I5F - CSPB_BACCL -
35 PsiBlast_CBE 78.2041%-177 - C5 -4A75 - ? -
27 PsiBlast_CBE 78.1041%-165 - C5 -4ALP - ? -
32 PsiBlast_CBE 78.0641%-170 - C5 -4A76 - ? -
5 PsiBlast_PDB 77.8269%-111 - C5 -1C9O 2.1 CSPB_BACCL
36 PsiBlast_CBE 77.7641%-168 - C5 -4A75 - ? -
28 PsiBlast_CBE 77.5541%-157 - C5 -4ALP - ? -
26 PsiBlast_CBE 77.5041%-168 - C5 -4ALP - ? -
33 PsiBlast_CBE 77.4541%-174 - C5 -4A75 - ? -
75 HHSearch 77.2261%-100 - C5 -3A0J - ? -
30 PsiBlast_CBE 77.0941%-173 - C5 -4A76 - ? -
24 PsiBlast_CBE 76.8970%-102 - C5 -3PF5 6.9 CSPB_BACSU
18 PsiBlast_PDB 76.6170%-109 - C5 -3PF5 2.8 CSPB_BACSU
11 PsiBlast_PDB 75.6670%-111 - C5 -2ES2 9.7 CSPB_BACSU
25 PsiBlast_CBE 75.2570% -96 - C5 -3PF4 7.3 CSPB_BACSU
17 PsiBlast_PDB 74.8070%-110 - C5 -3PF4 Error CSPB_BACSU
22 PsiBlast_CBE 72.6869% -99 - C5 -1C9O 2.1 CSPB_BACCL
89 HHSearch 72.3741%-113 * C5 *3TS2 11.9 LN28A_MOUSE