@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu05480: (2016-06-08 )
MAEFTHLVNERRSASNFLSGHPITKEDLNEMFELVALAPSAFNLQHTKYVTVLDQDVKEKLKQAANGQYKVVSSSAVLLVLGDKQAYQQAADIYEGLKVLGILNKQEYDHMVQDTVSFYENRGEQFKRDEAIRNASLSAMMFMLSAKEKGWDTCPMIGFDAEAVKRILNIDDQFEVVMMITIGKEKTESRRPRGYRKPVNEFVEYM

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FMN_B_6(3BEM)
MHQN_BACSU
[Raw transfer]




FMN_B_6(3BEM)
MHQN_BACSU
[Raw transfer]




FMN_B_4(3GE6)
?
[Raw transfer]




45 HHSearch 87.4999%-111 * C2 *3BEM 3.2 MHQN_BACSU
1 PsiBlast_PDB 85.9594%-111 - C2 -3BEM 3.2 MHQN_BACSU
4 PsiBlast_PDB 68.5030%-140 - C2 -4QLX - ? -
62 HHSearch 67.8427%-134 - C2 -4QLX - ? -
5 PsiBlast_PDB 67.1030%-126 - C2 -4QLY - ? -
55 HHSearch 64.1628%-121 - C2 -3GE6 - ? -
3 PsiBlast_PDB 63.7127%-118 - C2 -3GE6 3.0 ?
50 HHSearch 63.4724%-132 - C2 -1NOX - NOX_THET8 -
53 HHSearch 60.6528%-111 - C2 -3GBH - ? -
44 HHSearch 59.7428%-108 - C2 -3GAG - ? -
9 PsiBlast_PDB 58.6726%-179 - C2 -1NOX - NOX_THET8 -
7 PsiBlast_PDB 57.5925%-110 - C2 -3GAG - ? -
2 PsiBlast_PDB 56.3529%-104 - C2 -3GBH - ? -
15 PsiBlast_PDB 56.3420%-111 - C2 -3H4O - ? -
61 HHSearch 55.2516%-151 - C2 -3GB5 - IYD1_MOUSE -
11 PsiBlast_PDB 55.0723%-140 - C2 -3QDL - RDXA_HELPY -
58 HHSearch 54.9620%-129 - C2 -3G14 - ? -
8 PsiBlast_PDB 54.8023%-110 - C2 -3OF4 - ? -
46 HHSearch 54.6720%-119 - C2 -3N2S - NFRA1_BACSU -
13 PsiBlast_PDB 54.5920%-126 - C2 -4EO3 - ? -