@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu05840: (2016-06-09 )
MAHTEQYRFPKDFWWGSSASATQMEGAADRDGKGQNIWDYWFEKEPHRFFDHVGPADTSQFYDNYKEDIRLMKELGHNSFRMSISWSRLIPNGTGEINDKAADFYNNVIDELIANGIEPFVNLFHFDMPMALQKIGGWVNRETVDAYENYARTCFRLFGGRVKKWFTHNEPIVPVEGGYLYDFHYPNKVDFKEAVQVGFHTMLSSARAIQAYREMKQDGKIGIILNLTPSYPRSSHPADVKAGEIADAFFNRSFLDPSVKGEFPKELVDILKHEGFMPDYNAEDLDIIKKNTVDLLGVNYYQPRRVKAKEHLPNPDAPFLPDRYFDPYVMPGRKMNPHRGWEIYEKGVYDILINLKENYGNIECFISENGMGVEGEERFRDEQGIIQDDYRIEFIKEHLKWIHRAIQEGSNVKGYHLWTFMDNWSWTNAYKNRYGFVSVNLEKDGERTVKKSGKWFKEVAEHSGF

Atome Classification :

(66 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOX_A_7(2J78)
BGLA_THEMA
[Raw transfer]




GIM_B_7(2CES)
BGLA_THEMA
[Raw transfer]




GIM_A_4(2CES)
BGLA_THEMA
[Raw transfer]




BGC_A_2(4HZ8)
?
[Raw transfer]




NOY_B_6(2J75)
BGLA_THEMA
[Raw transfer]




MVL_A_2(4RE2)
?
[Raw transfer]




NTZ_B_5(2J7B)
BGLA_THEMA
[Raw transfer]




TCB_A_3(4PTV)
?
[Raw transfer]




GOX_B_9(2J78)
BGLA_THEMA
[Raw transfer]




GTL_B_5(2J79)
BGLA_THEMA
[Raw transfer]




TCB_B_6(4PTV)
?
[Raw transfer]




IFL_B_4(1UZ1)
BGLA_THEMA
[Raw transfer]




NOY_A_4(2J75)
BGLA_THEMA
[Raw transfer]




IFL_A_3(1UZ1)
BGLA_THEMA
[Raw transfer]




NOJ_A_3(1OIM)
BGLA_THEMA
[Raw transfer]




GTL_A_3(2J79)
BGLA_THEMA
[Raw transfer]




CTS_B_6(2CBU)
BGLA_THEMA
[Raw transfer]




BGC_A_2(4HZ7)
?
[Raw transfer]




CGB_B_5(2CBV)
BGLA_THEMA
[Raw transfer]




NOJ_B_5(2J77)
BGLA_THEMA
[Raw transfer]




OXZ_A_3(1W3J)
BGLA_THEMA
[Raw transfer]




CTS_A_3(2CBU)
BGLA_THEMA
[Raw transfer]




CGB_A_3(2CBV)
BGLA_THEMA
[Raw transfer]




IFM_A_3(1OIF)
BGLA_THEMA
[Raw transfer]




AZF_B_7(2J7H)
BGLA_THEMA
[Raw transfer]




SRT_A_24(3CMJ)
?
[Raw transfer]




OXZ_B_4(1W3J)
BGLA_THEMA
[Raw transfer]




BGC_A_3(4PTX)
?
[Raw transfer]




BGC_B_5(4PTX)
?
[Raw transfer]




BGC_A_2(3WH6)
?
[Raw transfer]




NOJ_B_4(1OIM)
BGLA_THEMA
[Raw transfer]




IFM_B_4(1OIF)
BGLA_THEMA
[Raw transfer]




GOL_B_9(2RGL)
BGL07_ORYSJ
[Raw transfer]




GOL_A_8(2RGL)
BGL07_ORYSJ
[Raw transfer]




YLL_B_6(2JAL)
BGLA_THEMA
[Raw transfer]




GOL_S_19(2DGA)
HGL1B_WHEAT
[Raw transfer]




GOL_S_19(2DGA)
HGL1B_WHEAT
[Raw transfer]




GOL_A_3(3WH5)
?
[Raw transfer]




GOL_A_3(3AIU)
HGGL_SECCE
[Raw transfer]




FCB_A_2(3WH7)
?
[Raw transfer]




IFM_A_3(3WH8)
?
[Raw transfer]




G2F_A_9(1E4I)
BGLA_PAEPO
[Raw transfer]




TRS_A_2(3W53)
?
[Raw transfer]




NCW_B_7(2VRJ)
BGLA_THEMA
[Raw transfer]




G2F_A_2(3AIR)
HGL1B_WHEAT
[Raw transfer]




G2F_B_5(4PTW)
?
[Raw transfer]




G2F_A_3(4PTW)
?
[Raw transfer]




G2F_B_4(2RGM)
BGL07_ORYSJ
[Raw transfer]




G2F_A_3(1OIN)
BGLA_THEMA
[Raw transfer]




G2F_A_3(2RGM)
BGL07_ORYSJ
[Raw transfer]




GOL_A_2(4HZ6)
?
[Raw transfer]




G2F_A_3(3AIW)
HGGL_SECCE
[Raw transfer]




G2F_B_4(1OIN)
BGLA_THEMA
[Raw transfer]




109 HHSearch 91.7750% -74 - C2 -5FOO - ? -
3 PsiBlast_PDB 89.8149% -68 - C2 -5FOO - ? -
25 PsiBlast_CBE 89.6749% -70 - C2 -5FOO - ? -
24 PsiBlast_CBE 89.1149% -68 - C2 -5FOO - ? -
21 PsiBlast_CBE 88.5549% -68 - C2 -5FOO - ? -
1 PsiBlast_PDB 87.5349% -71 - C2 -4B3K - ? -
2 PsiBlast_PDB 86.8949% -68 - C2 -4B3L - ? -
123 Fugue 86.1137% -89 * C2 *1E4I - BGLA_PAEPO -
27 PsiBlast_CBE 84.5840% -75 - C2 -3AHX - ? -
110 HHSearch 84.5435% -79 - C2 -4RE2 4.2 ?
31 PsiBlast_CBE 83.0239% -74 - C2 -4PTV 4.0 ?
4 PsiBlast_PDB 83.0240% -76 - C2 -3AHX - ? -
28 PsiBlast_CBE 82.9640% -75 - C2 -3AHX - ? -
26 PsiBlast_CBE 82.6540% -73 - C2 -3AHX - ? -
29 PsiBlast_CBE 82.2639% -73 - C2 -4PTX 3.5 ?
30 PsiBlast_CBE 82.0439% -72 - C2 -4PTW 2.8 ?
5 PsiBlast_PDB 81.6839% -72 - C2 -4PTV 4.1 ?
10 PsiBlast_PDB 81.6136% -80 - C2 -1UYQ - BGLA_PAEPO -
9 PsiBlast_PDB 81.5136% -77 - C2 -1E4I 2.4 BGLA_PAEPO
79 PsiBlast_CBE 81.2336% -78 - C2 -1OIN 3.9 BGLA_THEMA
77 PsiBlast_CBE 80.9736% -78 - C2 -1W3J 3.5 BGLA_THEMA
17 PsiBlast_PDB 80.9236% -76 - C2 -1W3J 3.7 BGLA_THEMA
15 PsiBlast_PDB 80.9136% -79 - C2 -1OIM 4.0 BGLA_THEMA
7 PsiBlast_PDB 80.8539% -74 - C2 -4PTX 3.5 ?
20 PsiBlast_PDB 80.5736% -77 - C2 -2CBV 4.0 BGLA_THEMA
41 PsiBlast_CBE 80.4536% -80 - C2 -3WH6 4.2 ?
14 PsiBlast_PDB 80.4136% -78 - C2 -1OIF 3.6 BGLA_THEMA
68 PsiBlast_CBE 80.3436% -77 - C2 -2J78 4.3 BGLA_THEMA
78 PsiBlast_CBE 80.3036% -77 - C2 -1UZ1 3.8 BGLA_THEMA
81 PsiBlast_CBE 80.2136% -77 - C2 -1OIF 3.4 BGLA_THEMA
67 PsiBlast_CBE 79.8036% -78 - C2 -2J78 4.3 BGLA_THEMA
58 PsiBlast_CBE 79.7336% -78 - C2 -2J7H 3.6 BGLA_THEMA
75 PsiBlast_CBE 79.6536% -76 - C2 -2CBV 4.2 BGLA_THEMA
16 PsiBlast_PDB 79.6536% -76 - C2 -1OIN 2.8 BGLA_THEMA
76 PsiBlast_CBE 79.6236% -76 - C2 -2CBU 4.5 BGLA_THEMA
65 PsiBlast_CBE 79.6136% -78 - C2 -2J79 3.8 BGLA_THEMA
19 PsiBlast_PDB 79.5636% -79 - C2 -2CBU 4.7 BGLA_THEMA
69 PsiBlast_CBE 79.5436% -77 - C2 -2J77 4.0 BGLA_THEMA
80 PsiBlast_CBE 79.4836% -76 - C2 -1OIM 4.1 BGLA_THEMA
40 PsiBlast_CBE 79.4236% -77 - C2 -3WH7 3.3 ?
57 PsiBlast_CBE 79.3536% -78 - C2 -2JAL 3.5 BGLA_THEMA
42 PsiBlast_CBE 79.3236% -78 - C2 -3WH5 2.9 ?
71 PsiBlast_CBE 79.2436% -79 - C2 -2J75 4.3 BGLA_THEMA
73 PsiBlast_CBE 79.1936% -77 - C2 -2CES 4.2 BGLA_THEMA
55 PsiBlast_CBE 79.0636% -77 - C2 -2VRJ 5.3 BGLA_THEMA
74 PsiBlast_CBE 79.0136% -75 - C2 -2CES 4.5 BGLA_THEMA
64 PsiBlast_CBE 78.8236% -76 - C2 -2J7B 4.2 BGLA_THEMA
70 PsiBlast_CBE 78.7636% -77 - C2 -2J75 4.4 BGLA_THEMA
6 PsiBlast_PDB 78.6539% -71 - C2 -4PTW 2.6 ?
18 PsiBlast_PDB 78.5036% -77 - C2 -1UZ1 3.8 BGLA_THEMA
66 PsiBlast_CBE 78.3736% -77 - C2 -2J79 3.8 BGLA_THEMA
85 PsiBlast_CBE 78.1532% -74 - C2 -4HZ6 2.9 ?
39 PsiBlast_CBE 78.0936% -79 - C2 -3WH8 3.7 ?
83 PsiBlast_CBE 78.0532% -74 - C2 -4HZ8 4.0 ?
84 PsiBlast_CBE 77.9332% -74 - C2 -4HZ7 3.7 ?
99 PsiBlast_CBE 77.2433% -69 - C2 -2RGL 2.7 BGL07_ORYSJ
97 PsiBlast_CBE 77.1633% -70 - C2 -2RGM 2.5 BGL07_ORYSJ
100 PsiBlast_CBE 76.7333% -69 - C2 -2RGL 2.7 BGL07_ORYSJ
82 PsiBlast_CBE 76.6331% -72 - C2 -3CMJ 3.2 ?
98 PsiBlast_CBE 75.8733% -70 - C2 -2RGM 3.4 BGL07_ORYSJ
87 PsiBlast_CBE 74.9433% -61 - C2 -3AIR 2.1 HGL1B_WHEAT
104 HHSearch 73.0033% -58 - C2 -2DGA 2.9 HGL1B_WHEAT
86 PsiBlast_CBE 72.9034% -64 - C2 -3W53 2.4 ?
89 PsiBlast_CBE 72.6533% -58 - C2 -2DGA 2.9 HGL1B_WHEAT
94 PsiBlast_CBE 72.0533% -60 - C2 -3AIW 2.9 HGGL_SECCE
96 PsiBlast_CBE 71.1233% -59 - C2 -3AIU 2.4 HGGL_SECCE