@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu05880: (2016-06-09 )
MLKKLAVCLSIVLLLLGAASPISAHTVYPVNPNAQQTTKDIMNWLAHLPNRSENRVMSGAFGGYSDVTFSMTEENRLKNATGQSPAIYGCDYGRGWLETADITDTIDYCCNSSLISYWKSGGLPQVSLHLANPAFPSGNYKTAISNSQYKNILDPSTVEGKRLEALLSKIADGLTQLKNQGVTVLFRPLHEMNGEWFWWGLTGYNQKDNERISLYKELYKKIYRYMTETRGLDNLLWVYSPDANRDFKTDFYPGSSYVDITGLDAYFTDPYAISGYDEMLSLKKPFAFAETGPSGNIGSFDYAAFINAIRQKYPQTTYFLTWDEQLSPAANQGAQSLYQNSWTLNKGEIWNGGSLTPIAE

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TRS_A_3(2WHK)
MANB_BACSU
[Raw transfer]




MAB_A_2(2VX7)
?
[Raw transfer]




GOL_A_7(2QHA)
?
[Raw transfer]




GOL_A_5(2QHA)
?
[Raw transfer]




MVL_A_5(4CD5)
?
[Raw transfer]




GOL_B_8(2QHA)
?
[Raw transfer]




GOL_B_9(2QHA)
?
[Raw transfer]




IFM_A_5(4CD4)
?
[Raw transfer]




MAF_A_6(1GW1)
MANA_CELJU
[Raw transfer]




FMT_A_5(2X2Y)
?
[Raw transfer]




FMT_A_4(2X2Y)
?
[Raw transfer]




MBF_A_6(1GVY)
MANA_CELJU
[Raw transfer]




ACY_A_3(3TP4)
?
[Raw transfer]




SUGAR_A_6(2WHM)
MANA_CELJU
[Raw transfer]

-

23 Fugue 89.7177% -83 - C1 -3CBW - MANB_BACSU -
21 PsiBlast_CBE 88.1375% -85 - C1 -3CBW - MANB_BACSU -
2 PsiBlast_PDB 87.6575% -77 - C1 -2QHA 2.8 ?
3 PsiBlast_PDB 87.5475% -80 - C1 -2WHK 4.2 MANB_BACSU
33 HHSearch 86.9276% -73 - C1 -3CBW - MANB_BACSU -
1 PsiBlast_PDB 86.6475% -73 - C1 -3CBW - MANB_BACSU -
22 PsiBlast_CBE 86.4975% -72 - C1 -2QHA 2.8 ?
36 HHSearch 59.5826% -89 - C1 -3ZM8 - ? -
37 HHSearch 57.3928% -74 - C1 -4YN5 - ? -
38 HHSearch 57.1923% -70 - C1 -1ODZ - MANA_CELJU -
34 HHSearch 56.0525% -80 - C1 -4CD5 - ? -
5 PsiBlast_PDB 53.7827% -81 - C1 -3ZM8 - ? -
24 Fugue 50.2522% -68 - C1 -1J9Y - MANA_CELJU -
40 HHSearch 49.5820%-106 * C1 *2V3G - GUNH_CLOTH -
39 HHSearch 49.2522% -68 - C1 -3TP4 3.6 ?
14 PsiBlast_PDB 47.7026% -76 - C1 -2BVY - ? -
19 PsiBlast_PDB 46.7625% -62 - C1 -1GVY 2.3 MANA_CELJU
20 PsiBlast_PDB 46.3425% -61 - C1 -1GW1 2.5 MANA_CELJU
26 Fugue 46.1923% -67 - C1 -2BVY - ? -
12 PsiBlast_PDB 46.1426% -74 - C1 -2X2Y 3.3 ?