@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu05970: (2016-06-09 )
MNKDQSKIPQATAKRLPLYYRFLKNLHASGKQRVSSAELSDAVKVDSATIRRDFSYFGALGKKGYGYNVDYLLSFFRKTLDQDEMTDVILIGVGNLGTAFLHYNFTKNNNTKISMAFDINESKIGTEVGGVPVYNLDDLEQHVKDESVAILTVPAVAAQSITDRLVALGIKGILNFTPARLNVPEHIRIHHIDLAVELQSLVYFLKHYSVLEEIE

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_A_3(2VT3)
REX_BACSU
[Raw transfer]




ATP_A_3(2VT3)
REX_BACSU
[Raw transfer]




ATP_B_4(2VT3)
REX_BACSU
[Raw transfer]




ATP_A_3(2VT3)
REX_BACSU
[Raw transfer]




NAD_A_3(2VT2)
REX_BACSU
[Raw transfer]




NAD_B_4(2VT2)
REX_BACSU
[Raw transfer]




20 PsiBlast_CBE 85.86100%-172 - C8 -2VT3 6.8 REX_BACSU
1 PsiBlast_PDB 82.68100%-210 - C8 -2VT2 5.8 REX_BACSU
21 PsiBlast_CBE 82.03100%-172 - C8 -2VT2 4.8 REX_BACSU
2 PsiBlast_PDB 81.79100%-209 - C8 -2VT3 6.4 REX_BACSU
48 HHSearch 81.6099%-209 - C8 -2VT3 6.4 REX_BACSU
41 Fugue 79.9897%-206 - C8 -2VT3 6.4 REX_BACSU
50 HHSearch 68.1247%-170 - C8 -3KEO - REX_STRA3 -
3 PsiBlast_PDB 67.6246%-178 - C8 -3KEO - REX_STRA3 -
22 PsiBlast_CBE 67.3446%-181 - C8 -3KEQ - REX_STRA3 -
5 PsiBlast_PDB 66.4946%-174 - C8 -3KET - REX_STRA3 -
23 PsiBlast_CBE 66.3446%-179 - C8 -3KEO - REX_STRA3 -
4 PsiBlast_PDB 64.8946%-200 - C8 -3KEQ - REX_STRA3 -
8 PsiBlast_PDB 63.7836%-165 - C8 -3IKT - REX_THET2 -
24 PsiBlast_CBE 63.0535%-171 - C8 -2DT5 - REX_THET8 -
25 PsiBlast_CBE 63.0336%-164 - C8 -3IKT - REX_THET2 -
14 PsiBlast_PDB 62.6133%-170 - C8 -3WGI - ? -
30 PsiBlast_CBE 62.5136%-161 - C8 -1XCB - REX_THEAQ -
7 PsiBlast_PDB 62.3935%-161 - C8 -2DT5 - REX_THET8 -
10 PsiBlast_PDB 62.3636%-166 - C8 -3IL2 - REX_THET2 -
49 HHSearch 62.1336%-161 - C8 -2DT5 - REX_THET8 -