@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu06300: (2016-06-10 )
MTLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHTIHHSDSQHEEPEVKTVVHLHGGVTPDDSDGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINEDGSLFYPSAPENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGCGGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPSVQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITDPHK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

OXY_A_7(4Q8B)
COTA_BACSU
[Raw transfer]




OXY_A_6(3ZDW)
COTA_BACSU
[Raw transfer]




OXY_A_6(2X88)
COTA_BACSU
[Raw transfer]




OXY_A_6(1W6L)
COTA_BACSU
[Raw transfer]




OXY_A_6(4AKQ)
COTA_BACSU
[Raw transfer]




C1O_A_5(1OF0)
COTA_BACSU
[Raw transfer]




C2O_A_7(1GSK)
COTA_BACSU
[Raw transfer]




C2O_A_7(1GSK)
COTA_BACSU
[Raw transfer]




C2O_A_8(2YXV)
CUEO_ECOLI
[Raw transfer]




22 PsiBlast_CBE 79.71100% -57 - C3 -4Q89 - COTA_BACSU -
10 PsiBlast_PDB 79.47100% -57 - C3 -4Q8B 3.2 COTA_BACSU
21 PsiBlast_CBE 79.09100% -58 - C3 -4Q8B - COTA_BACSU -
3 PsiBlast_PDB 79.08100% -54 - C3 -1W6L 3.0 COTA_BACSU
11 PsiBlast_PDB 79.06100% -53 - C3 -4YVN - ? -
14 PsiBlast_PDB 79.0599% -54 - C3 -4AKQ 3.5 COTA_BACSU
15 PsiBlast_PDB 79.0099% -57 - C3 -4A66 - COTA_BACSU -
5 PsiBlast_PDB 78.93100% -52 - C3 -1W8E - COTA_BACSU -
12 PsiBlast_PDB 78.88100% -52 - C3 -4YVU - ? -
6 PsiBlast_PDB 78.85100% -53 - C3 -2BHF - COTA_BACSU -
7 PsiBlast_PDB 78.76100% -53 - C3 -2X88 3.3 COTA_BACSU
13 PsiBlast_PDB 78.6799% -53 - C3 -4A68 - COTA_BACSU -
9 PsiBlast_PDB 78.62100% -57 - C3 -4Q89 - COTA_BACSU -
2 PsiBlast_PDB 78.50100% -54 - C3 -1OF0 2.6 COTA_BACSU
1 PsiBlast_PDB 78.44100% -53 - C3 -1GSK 2.3 COTA_BACSU
8 PsiBlast_PDB 78.39100% -55 - C3 -3ZDW 3.5 COTA_BACSU
4 PsiBlast_PDB 78.25100% -52 - C3 -1W6W - COTA_BACSU -
44 Fugue 77.9799% -53 - C3 -1GSK 2.3 COTA_BACSU
23 PsiBlast_CBE 57.7331% -60 - C3 -3GYR - PHSA_STRAT -
33 PsiBlast_CBE 57.5031% -59 - C3 -3GYR - PHSA_STRAT -