Study : bsu06510 (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C2_S1
Best Complexes choosen after comparative docking [pKd > 3] : 5 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C2_S1
Complex: GAR_D_4(1C3E) / Model_61(1C3E/A) = [3.1] Download866.121.57MKKFAVFASGNGSNFEAIVTRLKEENWDASAALLVCDKPQAKVIERAEAFHIPSFAFEPKSYENKAAFEQAIIEQLRLHEVELIALAGYMRLIGDTLLQAYGGKIINIHPSLLPAFPGIDAVGQAFRAGVKVAGITVHYVDEGMDTGPIIAQKAIEIDEHDTLETIEQRIHKLEHKWYPSVIKQLLGLNNRGEKA
Complex: GRF_B_2(1ZLY) / Model_19(1ZLY/A) = [3.2] Download833.553.38MKKFAVFASGNGSNFEAIVTRLKEENWDASAALLVCDKPQAKVIERAEAFHIPSFAFEPKSYENKAAFEQAIIEQLRLHEVELIALAGYMRLIGDTLLQAYGGKIINIHPSLLPAFPGIDAVGQAFRAGVKVAGITVHYVDEGMDTGPIIAQKAIEIDEHDTLETIEQRIHKLEHKWYPSVIKQLLGLNNRGEKA
Complex: GAR_A_3(4ZZ3) / Model_7(4ZZ3/A) = [3.2] Download1061.5114.12MKKFAVFASGNGSNFEAIVTRLKEENWDASAALLVCDKPQAKVIERAEAFHIPSFAFEPKSYENKAAFEQAIIEQLRLHEVELIALAGYMRLIGDTLLQAYGGKIINIHPSLLPAFPGIDAVGQAFRAGVKVAGITVHYVDEGMDTGPIIAQKAIEIDEHDTLETIEQRIHKLEHKWYPSVIKQLLGLNNRGEKA
Complex: GAR_F_6(1C2T) / Model_59(1C2T/A) = [3.2] Download854.195.54MKKFAVFASGNGSNFEAIVTRLKEENWDASAALLVCDKPQAKVIERAEAFHIPSFAFEPKSYENKAAFEQAIIEQLRLHEVELIALAGYMRLIGDTLLQAYGGKIINIHPSLLPAFPGIDAVGQAFRAGVKVAGITVHYVDEGMDTGPIIAQKAIEIDEHDTLETIEQRIHKLEHKWYPSVIKQLLGLNNRGEKA
Complex: GAR_E_5(1MEN) / Model_34(1MEN/B) = [3.6] Download782.764.65MKKFAVFASGNGSNFEAIVTRLKEENWDASAALLVCDKPQAKVIERAEAFHIPSFAFEPKSYENKAAFEQAIIEQLRLHEVELIALAGYMRLIGDTLLQAYGGKIINIHPSLLPAFPGIDAVGQAFRAGVKVAGITVHYVDEGMDTGPIIAQKAIEIDEHDTLETIEQRIHKLEHKWYPSVIKQLLGLNNRGEKA
Consensus
[pKd Mean = 3.26]
-879
(s=95)
5
(s=4)
MKKFAVFASGNGSNFEAIVTRLKEENWDASAALLVCDKPQAKVIERAEAFHIPSFAFEPKSYENKAAFEQAIIEQLRLHEVELIALAGYMRLIGDTLLQAYGGKIINIHPSLLPAFPGIDAVGQAFRAGVKVAGITVHYVDEGMDTGPIIAQKAIEIDEHDTLETIEQRIHKLEHKWYPSVIKQLLGLNNRGEKA