@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu06510: (2016-06-10 )
MKKFAVFASGNGSNFEAIVTRLKEENWDASAALLVCDKPQAKVIERAEAFHIPSFAFEPKSYENKAAFEQAIIEQLRLHEVELIALAGYMRLIGDTLLQAYGGKIINIHPSLLPAFPGIDAVGQAFRAGVKVAGITVHYVDEGMDTGPIIAQKAIEIDEHDTLETIEQRIHKLEHKWYPSVIKQLLGLNNRGEKA

Atome Classification :

(49 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

KEU_G_7(1NJS)

[Raw transfer]




KT5_H_8(1RBM)

[Raw transfer]




KEU_M_13(1RBQ)
PUR2_HUMAN
[Raw transfer]




KEU_N_14(1RBQ)

[Raw transfer]




KEU_L_12(1RBQ)
PUR2_HUMAN
[Raw transfer]




KEU_H_8(1RBY)

[Raw transfer]




KT5_D_4(1RBZ)

[Raw transfer]




KEU_F_6(1RBY)
PUR2_HUMAN
[Raw transfer]




KEU_K_11(1RBQ)
PUR2_HUMAN
[Raw transfer]




KT3_E_5(1RC1)
PUR2_HUMAN
[Raw transfer]




KT5_C_3(1RC0)
PUR2_HUMAN
[Raw transfer]




KT5_D_4(1RC0)

[Raw transfer]




KEU_F_6(1NJS)
PUR2_HUMAN
[Raw transfer]




KEU_G_7(1RBY)
PUR2_HUMAN
[Raw transfer]




KT5_G_7(1RBM)
PUR2_HUMAN
[Raw transfer]




KEU_E_5(1RBY)
PUR2_HUMAN
[Raw transfer]




KT3_F_6(1RC1)

[Raw transfer]




3YG_A_3(4ZZ2)

[Raw transfer]




GOL_A_5(3KCQ)
?
[Raw transfer]




GOL_A_5(3KCQ)
?
[Raw transfer]




GOL_B_6(3KCQ)
?
[Raw transfer]




GOL_C_7(3KCQ)
?
[Raw transfer]




GOL_D_8(3KCQ)
?
[Raw transfer]




THH_B_6(3DCJ)
PUR3_MYCTU
[Raw transfer]




THH_A_3(3DCJ)
PUR3_MYCTU
[Raw transfer]




GOL_F_6(1MEJ)

[Raw transfer]




GOL_B_13(3P9X)
?
[Raw transfer]




GAR_I_9(1RBY)
PUR2_HUMAN
[Raw transfer]




GAR_F_6(1C2T)
PUR3_ECOLI
[Raw transfer]




GAR_D_4(1C3E)
PUR3_ECOLI
[Raw transfer]




GAR_A_3(4ZZ3)

[Raw transfer]




GAR_D_4(1C2T)
PUR3_ECOLI
[Raw transfer]




GAR_D_4(1MEN)
PUR2_HUMAN
[Raw transfer]




GAR_F_6(1MEN)

[Raw transfer]




GAR_F_6(1C3E)
PUR3_ECOLI
[Raw transfer]




GAR_A_2(4ZZ1)

[Raw transfer]




GAR_A_2(4ZZ1)

[Raw transfer]




GAR_E_5(1MEN)
PUR2_HUMAN
[Raw transfer]




GAR_C_9(1CDE)
PUR3_ECOLI
[Raw transfer]




GAR_B_7(1CDE)
PUR3_ECOLI
[Raw transfer]




GAR_A_5(1CDE)
PUR3_ECOLI
[Raw transfer]




GAR_D_11(1CDE)
PUR3_ECOLI
[Raw transfer]




GRF_B_2(1ZLY)

[Raw transfer]




120 HHSearch 92.4153%-158 - C2 -3P9X - ? -
2 PsiBlast_PDB 91.7354%-162 - C2 -3P9X - ? -
21 PsiBlast_CBE 90.8854%-163 - C2 -3P9X 2.2 ?
122 HHSearch 88.1347%-163 - C2 -4S1N - ? -
3 PsiBlast_PDB 84.6844%-156 - C2 -4S1N - ? -
117 HHSearch 83.0760%-117 - C- -3AV3 - ? -
31 PsiBlast_CBE 82.6737%-160 - C2 -1RBM 7.5
118 HHSearch 82.6236%-163 - C2 -4ZZ1 4.3
25 PsiBlast_CBE 82.5137%-161 - C2 -1RBY 6.0
22 PsiBlast_CBE 82.4437%-163 - C2 -1RC1 7.9
14 PsiBlast_PDB 82.3937%-161 - C2 -1RC0 5.6 PUR2_HUMAN
24 PsiBlast_CBE 82.3737%-159 - C2 -1RBZ 6.5
32 PsiBlast_CBE 82.2337%-164 - C2 -1NJS 6.0
15 PsiBlast_PDB 82.0337%-162 - C2 -1RC1 6.3 PUR2_HUMAN
29 PsiBlast_CBE 82.0237%-162 - C2 -1RBQ 6.2 PUR2_HUMAN
28 PsiBlast_CBE 81.9337%-161 - C2 -1RBQ 6.0
119 HHSearch 81.9238%-154 - C2 -2YWR - ? -
27 PsiBlast_CBE 81.8637%-161 - C2 -1RBY 6.0 PUR2_HUMAN
5 PsiBlast_PDB 81.8537%-162 - C2 -4ZZ1 4.3
1 PsiBlast_PDB 81.7558%-116 - C- -3AV3 - ? -
26 PsiBlast_CBE 81.5437%-163 - C2 -1RBY 5.4 PUR2_HUMAN
126 HHSearch 81.5337%-182 - C2 -3KCQ 2.5 ?
30 PsiBlast_CBE 81.4837%-162 - C2 -1RBQ 5.9 PUR2_HUMAN
9 PsiBlast_PDB 81.3237%-159 - C2 -1NJS 6.1 PUR2_HUMAN
6 PsiBlast_PDB 81.0037%-162 - C2 -4ZZ2 5.1
11 PsiBlast_PDB 80.9637%-158 - C2 -1RBQ 6.1 PUR2_HUMAN
23 PsiBlast_CBE 80.9137%-162 - C2 -1RC0 5.2
12 PsiBlast_PDB 80.8937%-160 - C2 -1RBY 5.9 PUR2_HUMAN
7 PsiBlast_PDB 80.6437%-155 - C2 -4ZZ3 3.2
19 PsiBlast_PDB 80.5437%-162 - C2 -1ZLY 3.2
10 PsiBlast_PDB 80.3937%-159 - C2 -1RBM 6.1 PUR2_HUMAN
39 PsiBlast_CBE 79.8437%-178 - C2 -3KCQ 2.4 ?
38 PsiBlast_CBE 79.6837%-176 - C2 -3KCQ 2.7 ?
41 PsiBlast_CBE 79.3137%-182 - C2 -3KCQ 2.5 ?
40 PsiBlast_CBE 79.1937%-175 - C2 -3KCQ 2.3 ?
33 PsiBlast_CBE 78.9037%-155 - C2 -1MEN 3.9
36 PsiBlast_CBE 78.5737%-160 - C2 -1MEJ 2.8
35 PsiBlast_CBE 78.4937%-160 - C2 -1MEN 4.0 PUR2_HUMAN
34 PsiBlast_CBE 77.9037%-159 - C2 -1MEN 3.6 PUR2_HUMAN
63 PsiBlast_CBE 73.0435%-149 - C2 -3DCJ 4.9 PUR3_MYCTU
62 PsiBlast_CBE 73.0435%-147 - C2 -3DCJ 5.2 PUR3_MYCTU
54 PsiBlast_CBE 72.2131%-155 - C2 -1CDE 3.8 PUR3_ECOLI
53 PsiBlast_CBE 71.9331%-155 - C2 -1CDE 3.9 PUR3_ECOLI
55 PsiBlast_CBE 71.6731%-155 - C2 -1CDE 3.7 PUR3_ECOLI
52 PsiBlast_CBE 71.4331%-155 * C2 *1CDE 3.8 PUR3_ECOLI
59 PsiBlast_CBE 70.7631%-150 - C2 -1C2T 3.2 PUR3_ECOLI
61 PsiBlast_CBE 70.6031%-150 - C2 -1C3E 3.1 PUR3_ECOLI
58 PsiBlast_CBE 69.5831%-150 - C2 -1C2T 2.9 PUR3_ECOLI
60 PsiBlast_CBE 69.4931%-150 - C2 -1C3E 3.0 PUR3_ECOLI