@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu06530: (2016-06-10 )
MNVLIIGKGGREHTLAWKAAQSSLVENVFAAPGNDGMAASAQLVNIEESDHAGLVSFAKQNQVGLTIVGPEVPLIEGLVDEFEKAGLHVFGPSKAAAIIEGSKQFAKDLMKKYDIPTAEYETFTSFDEAKAYVQEKGAPIVIKADGLAAGKGVTVAMTEEEAIACLHDFLEDEKFGDASASVVIEEYLSGEEFSLMAFVKGEKVYPMVIAQDHKRAFDGDKGPNTGGMGAYSPVPQISEETVRHAVETIVKPAAKAMVQEGRSFTGVLYAGLMLTENGSKVIEFNARFGDPETQVVLPRMESDLVQVLLDLLDDKEVDLRWKDTAAVSVVLASEGYPESYAKGTPIGSLAAETEQVVVFHAGTKAEGGEFVTNGGRVANVTAFDETFEAARDRVYKAVDEIFKPGLFFRKDIGARALKAAQK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ANP_A_2(2XCL)
PUR2_BACSU
[Raw transfer]




ATP_B_6(2YW2)
PUR2_AQUAE
[Raw transfer]




ATP_A_8(2QK4)
PUR2_HUMAN
[Raw transfer]




ATP_A_5(2YW2)
PUR2_AQUAE
[Raw transfer]




ATP_A_8(2QK4)
PUR2_HUMAN
[Raw transfer]




AMP_A_4(2YRX)
?
[Raw transfer]




GOL_A_2(3MJF)
PUR2_YERPE
[Raw transfer]




1 PsiBlast_PDB 93.46100% -90 - C1 -2XD4 - PUR2_BACSU -
2 PsiBlast_PDB 91.9397% -93 - C1 -2XCL - PUR2_BACSU -
32 HHSearch 89.8396% -93 - C1 -2XCL 6.4 PUR2_BACSU
5 PsiBlast_PDB 82.4462%-110 - C1 -2YS6 - ? -
3 PsiBlast_PDB 82.3362%-112 - C1 -2YRW - ? -
4 PsiBlast_PDB 82.0462%-109 - C1 -2YRX - ? -
33 HHSearch 81.6261%-110 - C1 -2YRX 3.5 ?
21 PsiBlast_CBE 76.7452% -91 - C1 -2YW2 6.0 PUR2_AQUAE
7 PsiBlast_PDB 76.6352% -89 - C1 -2YW2 - PUR2_AQUAE -
10 PsiBlast_PDB 76.2951% -97 - C1 -3MJF - PUR2_YERPE -
8 PsiBlast_PDB 74.7252% -91 - C1 -2YYA - PUR2_AQUAE -
12 PsiBlast_PDB 74.2348%-101 - C1 -2IP4 - ? -
13 PsiBlast_PDB 74.0341%-102 - C1 -3LP8 - ? -
11 PsiBlast_PDB 73.9347%-101 - C1 -2QK4 5.5 PUR2_HUMAN
36 HHSearch 72.1748%-103 - C1 -2IP4 - ? -
34 HHSearch 72.1749% -93 - C1 -2YW2 6.4 PUR2_AQUAE
35 HHSearch 72.0440% -96 - C1 -3LP8 - ? -
37 HHSearch 71.6046%-102 - C1 -2QK4 5.5 PUR2_HUMAN
38 HHSearch 67.8649% -93 - C1 -3MJF 2.6 PUR2_YERPE
14 PsiBlast_PDB 62.8634% -75 - C1 -1VKZ - PUR2_THEMA -