@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu06620: (2016-06-10 )
MDKETAKQRAEELRRTINKYSYEYYTLDEPSVPDAEYDRLMQELIAIEEEHPDLRTPDSPTQRVGGAVLEAFQKVTHGTPMLSLGNAFNADDLRDFDRRVRQSVGDDVAYNVELKIDGLAVSLRYEDGYFVRGATRGDGTTGEDITENLKTIRNIPLKMNRELSIEVRGEAYMPKRSFEALNEERIKNEEEPFANPRNAAAGSLRQLDPKIAAKRNLDIFVYSIAELDEMGVETQSQGLDFLDELGFKTNQERKKCGSIEEVITLIDELQAKRADLPYEIDGIVIKVDSLDQQEELGFTAKSPRWAIAYKFPAEEVVTKLLDIELNVGRTGVITPTAILEPVKVAGTTVSRASLHNEDLIKEKDIRILDKVVVKKAGDIIPEVVNVLVDQRTGEEKEFSMPTECPECGSELVRIEGEVALRCINPECPAQIREGLIHFVSRNAMNIDGLGERVITQLFEENLVRNVADLYKLTKERVIQLERMGEKSTENLISSIQKSKENSLERLLFGLGIRFIGSKAAKTLAMHFESLENLKKASKEELLAVDEIGEKMADAVITYFHKEEMLELLNELQELGVNTLYKGPKKVKAEDSDSYFAGKTIVLTGKLEELSRNEAKAQIEALGGKLTGSVSKNTDLVIAGEAAGSKLTKAQELNIEVWNEEQLMGELKK

Atome Classification :

(36 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

AMP_D_10(2OWO)
DNLJ_ECOLI
[Raw transfer]




AMP_B_2(1ZAU)
DNLJ_MYCTU
[Raw transfer]




AMP_A_3(3UQ8)
DNLJ_HAEIN
[Raw transfer]




IVH_A_2(3PN1)
DNLJ_HAEIN
[Raw transfer]




AMP_A_3(3UQ8)
DNLJ_HAEIN
[Raw transfer]




IA7_A_2(4UFZ)
DNLJ_HAEIN
[Raw transfer]




D41_A_2(4UCO)
DNLJ_HAEIN
[Raw transfer]




9MJ_A_3(4UCS)
DNLJ_HAEIN
[Raw transfer]




0XT_B_6(4GLW)
DNLJ_STRZP
[Raw transfer]




0XS_A_7(4GLX)
DNLJ_ECOLI
[Raw transfer]




3B9_A_5(3BAC)
DNLJ_HAEIN
[Raw transfer]




NACID_D_3(4GLX)
DNLJ_ECOLI
[Raw transfer]

-

JCF_A_3(4UCR)
DNLJ_HAEIN
[Raw transfer]




NACID_D_3(4GLX)
DNLJ_ECOLI
[Raw transfer]

-

0XT_A_4(4GLW)
DNLJ_STRZP
[Raw transfer]




0XT_A_4(4GLW)
DNLJ_STRZP
[Raw transfer]




NACID_D_3(2OWO)
DNLJ_ECOLI
[Raw transfer]

-

5U1_A_3(4UCT)
DNLJ_HAEIN
[Raw transfer]




8HC_A_2(4UCU)
DNLJ_HAEIN
[Raw transfer]




NACID_D_3(2OWO)
DNLJ_ECOLI
[Raw transfer]

-

10L_A_4(5FPO)
DNLJ_STAAU
[Raw transfer]




NACID_C_2(2OWO)
DNLJ_ECOLI
[Raw transfer]

-

NACID_C_2(4GLX)
DNLJ_ECOLI
[Raw transfer]

-

I6G_A_3(4UCV)
DNLJ_HAEIN
[Raw transfer]




1 PsiBlast_PDB 76.4249% -87 - C6 -2OWO 6.3 DNLJ_ECOLI
2 PsiBlast_PDB 75.5648% -93 - C6 -4GLX 6.8 DNLJ_ECOLI
56 HHSearch 75.2750% -84 - C6 -2OWO 6.0 DNLJ_ECOLI
58 HHSearch 74.8848% -89 - C6 -4GLX 5.0 DNLJ_ECOLI
4 PsiBlast_PDB 74.5148% -72 - C6 -1V9P - DNLJ_THEFI -
22 PsiBlast_CBE 73.9948% -67 - C6 -1V9P - DNLJ_THEFI -
21 PsiBlast_CBE 72.3146% -62 - C6 -1DGS - DNLJ_THEFI -
45 Fugue 71.6646% -63 - C6 -1DGS - DNLJ_THEFI -
3 PsiBlast_PDB 71.2246% -61 - C6 -1DGS - DNLJ_THEFI -
55 HHSearch 69.5746% -58 - C6 -1DGS - DNLJ_THEFI -
26 PsiBlast_CBE 62.0761% 0 - C- -1TAE - DNLJ_ENTFA -
25 PsiBlast_CBE 62.0761% 0 - C- -1TAE - DNLJ_ENTFA -
24 PsiBlast_CBE 62.0761% 0 - C- -1TAE - DNLJ_ENTFA -
12 PsiBlast_PDB 62.0761% 0 - C- -1TAE - DNLJ_ENTFA -
18 PsiBlast_PDB 57.6261% -60 - C6 -4EEQ - DNLJ_ENTFA -
17 PsiBlast_PDB 57.5061% -59 - C6 -1TA8 - DNLJ_ENTFA -
20 PsiBlast_PDB 57.3561% -62 - C6 -4EFE - DNLJ_ENTFA -
13 PsiBlast_PDB 57.1861% -64 - C6 -3BA8 - DNLJ_ENTFA -
14 PsiBlast_PDB 57.0661% -62 - C6 -3BA9 - DNLJ_ENTFA -
61 HHSearch 56.8961% -60 - C6 -4LH6 - DNLJ_ENTFA -
59 HHSearch 50.6648% -55 - C6 -3UQ8 6.4 DNLJ_HAEIN
38 PsiBlast_CBE 49.4247% -55 - C6 -3UQ8 6.4 DNLJ_HAEIN
39 PsiBlast_CBE 48.8348% -55 - C6 -3PN1 7.0 DNLJ_HAEIN
29 PsiBlast_CBE 48.4252% -54 - C6 -4GLW 4.5 DNLJ_STRZP
30 PsiBlast_CBE 47.9752% -53 - C6 -4GLW 4.9 DNLJ_STRZP
64 HHSearch 47.8752% -54 * C6 *4GLW 4.9 DNLJ_STRZP
62 HHSearch 47.8742% -60 - C6 -1ZAU 4.4 DNLJ_MYCTU
31 PsiBlast_CBE 47.4847% -58 - C6 -4UFZ 6.8 DNLJ_HAEIN
36 PsiBlast_CBE 47.3647% -55 - C6 -4UCR 6.0 DNLJ_HAEIN
35 PsiBlast_CBE 47.2447% -58 - C6 -4UCS 5.4 DNLJ_HAEIN
33 PsiBlast_CBE 47.0747% -55 - C6 -4UCU 4.3 DNLJ_HAEIN
37 PsiBlast_CBE 46.9147% -53 - C6 -4UCO 6.9 DNLJ_HAEIN
34 PsiBlast_CBE 46.5847% -55 - C6 -4UCT 5.2 DNLJ_HAEIN
11 PsiBlast_PDB 46.4664% -49 - C6 -5FPO 2.4 DNLJ_STAAU
32 PsiBlast_CBE 46.2747% -52 - C6 -4UCV 4.7 DNLJ_HAEIN
41 PsiBlast_CBE 43.5445% -66 - C6 -3BAC 8.6 DNLJ_HAEIN