@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu07430: (2016-06-11 )
MTQTWPFLHNAQSFIQENWNASGFQKPTPVQEQAAQLIMDGKDVIAESPTGTGKTLAYALPVLERIKPEQKHPQAVILAPSRELVMQIFQVIQDWKAGSELRAASLIGGANVKKQVEKLKKHPHIIVGTPGRVFELIKAKKLKMHEVKTIVLDETDQLVLPEHRETMKQIIKTTLRDRQLLCFSATLKKETEDVLRELAQEPEVLKVQRSKAEAGKVKHQYLICDQRDKVKLLQKLSRLEGMQALVFVRDIGNLSVYAEKLAYHHVELGVLHSEAKKMERAKIIATFEDGEFPLLLATDIAARGLDIENLPYVIHADIPDEDGYVHRSGRTGRAGKEGNVLSLVTKLEESKLKKMAKKLGVELSEAVYAGGKLKTK

Atome Classification :

(51 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ANP_B_12(3FHT)
DD19B_HUMAN
[Raw transfer]




ANP_A_3(4D25)
?
[Raw transfer]




ANP_A_7(3FHT)
DD19B_HUMAN
[Raw transfer]




ANP_A_3(4D25)
?
[Raw transfer]




ADP_A_3(4D26)
?
[Raw transfer]




ANP_A_3(3G0H)
DD19B_HUMAN
[Raw transfer]




ADP_A_3(3PEY)
DBP5_YEAST
[Raw transfer]




ANP_A_7(2J0S)
IF4A3_HUMAN
[Raw transfer]




ADP_A_3(3PEW)
DBP5_YEAST
[Raw transfer]




8OD_B_7(3NBF)
?
[Raw transfer]




ADP_A_4(3RRM)
DBP5_YEAST
[Raw transfer]




ADP_B_4(2OXC)
DDX20_HUMAN
[Raw transfer]




M2A_A_3(5ELX)
?
[Raw transfer]




ADP_A_3(2OXC)
DDX20_HUMAN
[Raw transfer]




ADP_A_3(3DKP)
DDX52_HUMAN
[Raw transfer]




8OP_C_10(3NBF)
?
[Raw transfer]




AMP_A_8(2GXS)
?
[Raw transfer]




AMP_A_2(2GXQ)
?
[Raw transfer]




8OX_B_6(3MWL)
?
[Raw transfer]




ADP_B_4(3FMO)
DD19B_HUMAN
[Raw transfer]




ADP_A_3(3RRN)
DBP5_YEAST
[Raw transfer]




AMP_A_3(3BER)
DDX47_HUMAN
[Raw transfer]




8OP_B_6(3MWK)
?
[Raw transfer]




8OD_A_5(3NBF)
?
[Raw transfer]




ADP_A_3(3EWS)
DD19B_HUMAN
[Raw transfer]




AMP_B_9(2GXS)
?
[Raw transfer]




AMP_A_3(3IUY)
DDX53_HUMAN
[Raw transfer]




AMP_B_5(3IUY)
DDX53_HUMAN
[Raw transfer]




ADP_A_3(2PL3)
DDX10_HUMAN
[Raw transfer]




AMP_A_3(4KBF)
?
[Raw transfer]




FLC_D_4(1T6N)
DX39B_HUMAN
[Raw transfer]




FLC_C_3(1T6N)
DX39B_HUMAN
[Raw transfer]




1PE_A_4(4BRW)
DHH1_YEAST
[Raw transfer]




IPA_D_4(1XTI)
DX39B_HUMAN
[Raw transfer]




22 PsiBlast_CBE 82.0831%-126 - C4 -4CT4 - DDX6_HUMAN -
1 PsiBlast_PDB 82.0431%-132 - C4 -4CT4 - DDX6_HUMAN -
9 PsiBlast_PDB 80.2230%-113 - C4 -2HYI - IF4A3_HUMAN -
12 PsiBlast_PDB 80.0130%-111 - C4 -2J0S 8.0 IF4A3_HUMAN
10 PsiBlast_PDB 79.8530%-111 - C4 -3EX7 - IF4A3_HUMAN -
3 PsiBlast_PDB 79.7731%-136 - C4 -5ANR - DDX6_HUMAN -
8 PsiBlast_PDB 79.2930%-112 - C4 -2XB2 - IF4A3_HUMAN -
105 HHSearch 78.9029%-138 - C4 -5ANR - DDX6_HUMAN -
21 PsiBlast_CBE 78.8631%-131 - C4 -4CT5 - DDX6_HUMAN -
11 PsiBlast_PDB 78.6730%-108 - C4 -2J0Q - IF4A3_HUMAN -
113 HHSearch 78.5929%-141 - C4 -1XTI 2.5 DX39B_HUMAN
2 PsiBlast_PDB 78.5831%-130 - C4 -4CT5 - DDX6_HUMAN -
107 HHSearch 78.1029%-126 - C4 -1S2M - DHH1_YEAST -
6 PsiBlast_PDB 77.4730%-127 - C4 -1S2M - DHH1_YEAST -
121 HHSearch 76.7431%-128 - C4 -2I4I - DDX3X_HUMAN -
114 HHSearch 75.7530%-104 - C4 -2DB3 - VASA1_DROME -
109 HHSearch 75.6530%-106 - C4 -4D25 7.9 ?
4 PsiBlast_PDB 75.3230%-125 - C4 -4BRU - DHH1_YEAST -
7 PsiBlast_PDB 75.1730%-118 - C4 -2HXY - IF4A3_HUMAN -
13 PsiBlast_PDB 74.8929%-120 - C4 -1HV8 - H669_METJA -
5 PsiBlast_PDB 74.6530%-121 - C4 -4BRW 1.8 DHH1_YEAST
30 PsiBlast_CBE 74.3132%-137 - C4 -3EWS 6.4 DD19B_HUMAN
14 PsiBlast_PDB 74.2230%-107 - C4 -4D25 7.9 ?
15 PsiBlast_PDB 73.6530%-106 - C4 -4D26 5.8 ?
32 PsiBlast_CBE 73.6132%-127 - C4 -3FHT 8.7 DD19B_HUMAN
19 PsiBlast_PDB 72.9632%-134 - C4 -3RRM 5.9 DBP5_YEAST
20 PsiBlast_PDB 72.5932%-121 - C4 -3RRN 5.3 DBP5_YEAST
31 PsiBlast_CBE 72.5432%-127 - C4 -3FHT 9.3 DD19B_HUMAN
29 PsiBlast_CBE 72.2032%-124 - C4 -3G0H 8.1 DD19B_HUMAN
16 PsiBlast_PDB 71.4333%-110 - C4 -5ELX 9.1 ?
18 PsiBlast_PDB 71.4132%-112 - C4 -3PEW 8.0 DBP5_YEAST
36 PsiBlast_CBE 71.1432%-126 - C4 -4KBF 5.1 ?
17 PsiBlast_PDB 70.7533%-109 - C4 -3PEY 8.2 DBP5_YEAST
63 PsiBlast_CBE 62.5932%-149 - C4 -2OXC 6.2 DDX20_HUMAN
64 PsiBlast_CBE 61.9832%-145 - C4 -2OXC 6.0 DDX20_HUMAN
54 PsiBlast_CBE 59.4633%-143 - C4 -1T6N 3.0 DX39B_HUMAN
55 PsiBlast_CBE 59.1533%-146 - C4 -1T6N 2.7 DX39B_HUMAN
42 PsiBlast_CBE 58.6434%-130 - C4 -2GXQ 6.2 ?
48 PsiBlast_CBE 58.3333%-134 - C4 -3MWL 4.2 ?
41 PsiBlast_CBE 58.1334%-132 - C4 -2GXS 6.0 ?
40 PsiBlast_CBE 58.0134%-129 - C4 -2GXS 4.9 ?
47 PsiBlast_CBE 57.3733%-129 - C4 -3NBF 4.2 ?
46 PsiBlast_CBE 57.1633%-125 - C4 -3NBF 5.4 ?
50 PsiBlast_CBE 56.7533%-124 - C4 -3MWK 4.2 ?
45 PsiBlast_CBE 56.3033%-129 - C4 -3NBF 4.4 ?
56 PsiBlast_CBE 55.1433%-129 - C4 -3BER 5.7 DDX47_HUMAN
60 PsiBlast_CBE 54.9232%-136 - C4 -3FMO 6.3 DD19B_HUMAN
66 PsiBlast_CBE 54.6032%-163 - C4 -3IUY 5.7 DDX53_HUMAN
65 PsiBlast_CBE 53.8332%-156 - C4 -3IUY 6.2 DDX53_HUMAN
59 PsiBlast_CBE 53.1832%-143 - C4 -2PL3 4.9 DDX10_HUMAN
67 PsiBlast_CBE 50.2434%-128 - C4 -3DKP 6.4 DDX52_HUMAN