@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu07490: (2016-06-11 )
MGKLAADQLTLSYDSTVIIDGVDLKIEEGKITALIGANGCGKSTILKSLARLMAPKSGTVLLEGKDIHRQPSKEVAKKLAILPQSPQAPEGLTVEELCYFGRHPHKKLLSKHTQEDHDMVEWALEATGMIELKDRTLDALSGGQRQRAWISMALAQGTDLLLLDEPTTYLDISHQIEVLELLKKLNRDHGRTVVMVLHDLNQAAQYADYLISVLDGKIYNAGTPEDVFTQPFFREVFGLECCIMRSPIDQKPMCLPTGLCPKLRAK

Atome Classification :

(31 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_B_6(3FVQ)
FBPC_NEIG1
[Raw transfer]




ATP_A_3(3FVQ)
FBPC_NEIG1
[Raw transfer]




ATP_A_5(1L2T)
Y796_METJA
[Raw transfer]




ACP_A_4(4AYT)
ABCBA_HUMAN
[Raw transfer]




ATP_B_6(1L2T)
Y796_METJA
[Raw transfer]




ADP_A_6(3BK7)
?
[Raw transfer]




ACP_A_4(4AYX)
ABCBA_HUMAN
[Raw transfer]




ANP_A_2(4AYW)
ABCBA_HUMAN
[Raw transfer]




ADP_A_3(3TIF)
Y796_METJA
[Raw transfer]




ADP_B_3(3J15)
?
[Raw transfer]




ADP_B_8(3TIF)
Y796_METJA
[Raw transfer]




30 PsiBlast_CBE 84.1731% 0 - C- -4FWI - ? -
21 PsiBlast_CBE 75.4832%-145 - C1 -4G1U - HMUV_YERPE -
1 PsiBlast_PDB 74.3432%-144 - C1 -4G1U - HMUV_YERPE -
25 PsiBlast_CBE 71.0531%-137 - C1 -1VPL - ? -
4 PsiBlast_PDB 66.7633%-132 - C1 -4YMT - ? -
3 PsiBlast_PDB 64.7033%-134 - C1 -4YMS - ? -
7 PsiBlast_PDB 64.0733%-136 - C1 -4YMW - ? -
8 PsiBlast_PDB 63.8729%-129 - C1 -3GFO - ECFA3_CLOP1 -
18 PsiBlast_PDB 63.3529%-129 - C1 -1Q1E - MALK_ECOLI -
23 PsiBlast_CBE 63.0633%-136 - C1 -4YMU - ? -
5 PsiBlast_PDB 63.0133%-130 - C1 -4YMU - ? -
22 PsiBlast_CBE 62.3133%-130 - C1 -4YMV - ? -
9 PsiBlast_PDB 62.0029%-170 - C1 -2NQ2 - Y1470_HAEIN -
6 PsiBlast_PDB 60.4033%-131 - C1 -4YMV - ? -
67 HHSearch 58.9129%-129 - C1 -3RLF - MALK_ECOLI -
14 PsiBlast_PDB 58.2329%-112 - C1 -5D3M - ? -
16 PsiBlast_PDB 57.7929%-127 - C1 -1Q1B - MALK_ECOLI -
42 PsiBlast_CBE 57.2731%-107 - C1 -1B0U - HISP_SALTY -
26 PsiBlast_CBE 57.0131%-127 - C1 -4MKI - ECFA2_CALS4 -
63 HHSearch 56.8934%-116 - C1 -3FVQ - FBPC_NEIG1 -
24 PsiBlast_CBE 52.1534%-114 - C1 -3FVQ 5.3 FBPC_NEIG1
38 PsiBlast_CBE 49.6031%-124 - C1 -1L2T 4.5 Y796_METJA
15 PsiBlast_PDB 49.5134%-115 - C1 -3FVQ 6.8 FBPC_NEIG1
41 PsiBlast_CBE 48.7031%-117 - C1 -3TIF 4.3 Y796_METJA
40 PsiBlast_CBE 47.4931%-127 - C1 -3TIF 4.4 Y796_METJA
34 PsiBlast_CBE 45.8733%-115 - C1 -4AYW 4.0 ABCBA_HUMAN
39 PsiBlast_CBE 45.3731%-115 - C1 -1L2T 4.2 Y796_METJA
31 PsiBlast_CBE 44.5133%-120 - C1 -4AYX 3.9 ABCBA_HUMAN
32 PsiBlast_CBE 42.4633%-113 - C1 -4AYT 4.1 ABCBA_HUMAN
48 PsiBlast_CBE 29.4531%-125 - C1 -3BK7 3.8 ?
47 PsiBlast_CBE 18.0731%-124 - C1 -3J15 4.0 ?