@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu07630: (2016-06-12 )
MEEKEILWNEAKAFIAACYQELGKEEEVKDRLADIKSEIDLTGSYVHTKEELEHGAKMAWRNSNRCIGRLFWNSLNVIDRRDVRTKEEVRDALFHHIETATNNGKIRPTITIFPPEEKGEKQVEIWNHQLIRYAGYESDGERIGDPASCSLTAACEELGWRGERTDFDLLPLIFRMKGDEQPVWYELPRSLVIEVPITHPDIEAFSDLELKWYGVPIISDMKLEVGGIHYNAAPFNGWYMGTEIGARNLADEKRYDKLKKVASVIGIAADYNTDLWKDQALVELNKAVLHSYKKQGVSIVDHHTAASQFKRFEEQEEEAGRKLTGDWTWLIPPISPAATHIFHRSYDNSIVKPNYFYQDKPYE

Atome Classification :

(94 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

DP9_B_10(1ZZR)
NOS1_RAT
[Raw transfer]




HEM_A_2(4D3O)
NOSO_BACSU
[Raw transfer]




HEM_B_7(4D3K)
NOSO_BACSU
[Raw transfer]




GOL_A_8(4D3V)
NOSO_BACSU
[Raw transfer]




DP9_B_13(1ZZQ)
NOS1_RAT
[Raw transfer]




HAR_A_3(1M7Z)
NOSO_BACSU
[Raw transfer]




DP1_B_13(1P6K)
NOS1_RAT
[Raw transfer]




GOL_A_10(4D3T)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UGC)
NOSO_BACSU
[Raw transfer]




EXI_A_6(4UH5)
NOS1_HUMAN
[Raw transfer]




EXI_B_11(4UH5)
NOS1_HUMAN
[Raw transfer]




HEM_A_2(4D7H)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4D3T)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4D3M)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UG9)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4D3I)
NOSO_BACSU
[Raw transfer]




ARG_A_2(1M7V)
NOSO_BACSU
[Raw transfer]




ARG_B_4(2FLQ)
?
[Raw transfer]




HEM_A_2(4UQS)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4D3J)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UGV)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4D7I)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4D3V)
NOSO_BACSU
[Raw transfer]




HEM_B_8(4UH6)
NOS1_HUMAN
[Raw transfer]




HEM_A_2(4UGW)
NOSO_BACSU
[Raw transfer]




HEM_B_11(3N63)
NOS1_RAT
[Raw transfer]




HEM_A_2(4UG5)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UGK)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UQR)
NOSO_BACSU
[Raw transfer]




HEM_B_11(3N61)
NOS1_RAT
[Raw transfer]




HEM_A_2(4D7J)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UGY)
NOSO_BACSU
[Raw transfer]




0GD_A_5(4D7I)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4LWA)
NOSO_BACSU
[Raw transfer]




HEM_B_7(5ADF)
NOS1_HUMAN
[Raw transfer]




HEM_B_8(5ADG)
NOS1_HUMAN
[Raw transfer]




HEM_B_8(3JX4)
NOS1_RAT
[Raw transfer]




HEM_A_2(4UGD)
NOSO_BACSU
[Raw transfer]




HEM_A_2(2AN0)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4D3N)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UGA)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UGS)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UGQ)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UGM)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UGE)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UG7)
NOSO_BACSU
[Raw transfer]




HEM_B_8(5ADD)
NOS1_RAT
[Raw transfer]




HEM_B_10(3NLP)
NOS1_RAT
[Raw transfer]




HEM_A_2(4D3U)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UGL)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UGT)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UGX)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UGB)
NOSO_BACSU
[Raw transfer]




HEM_B_9(3DQR)
NOS1_RAT
[Raw transfer]




HEM_B_8(3NLR)
NOS1_RAT
[Raw transfer]




HEM_A_3(5ADG)
NOS1_HUMAN
[Raw transfer]




HEM_A_3(1M7V)
NOSO_BACSU
[Raw transfer]




HEM_B_9(3JX2)
NOS1_RAT
[Raw transfer]




HEM_A_2(4UGJ)
NOSO_BACSU
[Raw transfer]




HEM_A_3(4D3K)
NOSO_BACSU
[Raw transfer]




HEM_A_5(2FLQ)
?
[Raw transfer]




HEM_A_2(4UG6)
NOSO_BACSU
[Raw transfer]




HEM_B_6(2FLQ)
?
[Raw transfer]




HEM_A_2(4UGF)
NOSO_BACSU
[Raw transfer]




H4B_A_3(4UGV)
NOSO_BACSU
[Raw transfer]




HEM_A_3(2FC2)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UG8)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UGI)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UGP)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UGR)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UGO)
NOSO_BACSU
[Raw transfer]




HEM_A_2(4UGU)
NOSO_BACSU
[Raw transfer]




HEM_B_8(5ADE)
NOS1_RAT
[Raw transfer]




HEM_B_8(4UH5)
NOS1_HUMAN
[Raw transfer]




HEM_A_2(2FC1)
NOSO_BACSU
[Raw transfer]




HBI_A_7(2FC2)
NOSO_BACSU
[Raw transfer]




HEM_A_2(1M7Z)
NOSO_BACSU
[Raw transfer]




HEM_A_3(2AN2)
NOSO_BACSU
[Raw transfer]




GOL_B_12(4CX3)
NOS1_RAT
[Raw transfer]




HEM_B_9(2FC2)
NOSO_BACSU
[Raw transfer]




HEM_B_7(5ADI)
NOS1_HUMAN
[Raw transfer]




HEM_A_2(4UGH)
NOSO_BACSU
[Raw transfer]




HEM_A_3(4UH6)
NOS1_HUMAN
[Raw transfer]




HEM_A_2(4UGN)
NOSO_BACSU
[Raw transfer]




HEM_B_11(1ZZU)
NOS1_RAT
[Raw transfer]




HEM_B_11(1P6K)
NOS1_RAT
[Raw transfer]




HEM_A_2(4UGG)
NOSO_BACSU
[Raw transfer]




HEM_B_8(3JX3)
NOS1_RAT
[Raw transfer]




HEM_A_3(5ADF)
NOS1_HUMAN
[Raw transfer]




HEM_A_2(4LWB)
NOSO_BACSU
[Raw transfer]




HEM_B_9(3NLQ)
NOS1_RAT
[Raw transfer]




H4B_A_3(4UGW)
NOSO_BACSU
[Raw transfer]




HEM_B_8(3JX5)
NOS1_RAT
[Raw transfer]




HEM_B_11(1ZZQ)
NOS1_RAT
[Raw transfer]




HEM_A_3(5ADI)
NOS1_HUMAN
[Raw transfer]




HEM_B_8(1ZZR)
NOS1_RAT
[Raw transfer]




HEM_B_4(2AMO)
NOSO_BACSU
[Raw transfer]




HEM_B_7(4CX4)
NOS1_RAT
[Raw transfer]




H2B_X_3(2FBZ)
NOSO_BACSU
[Raw transfer]




HEM_B_7(4UCH)
NOS1_HUMAN
[Raw transfer]




HEM_A_3(4UCH)
NOS1_HUMAN
[Raw transfer]




HBI_B_8(2FC2)
NOSO_BACSU
[Raw transfer]




HEM_X_2(2FBZ)
NOSO_BACSU
[Raw transfer]




HEM_A_3(2AMO)
NOSO_BACSU
[Raw transfer]




HEM_B_8(4CX3)
NOS1_RAT
[Raw transfer]




HEM_A_3(4UH5)
NOS1_HUMAN
[Raw transfer]




HEM_A_3(3JX2)
NOS1_RAT
[Raw transfer]




NAD_A_10(1MJT)
NOSO_STAAU
[Raw transfer]




NAD_A_7(1MJT)
NOSO_STAAU
[Raw transfer]




NAD_A_7(1MJT)
NOSO_STAAU
[Raw transfer]




14 PsiBlast_PDB 88.0199% -88 - C7 -4UG6 11.5 NOSO_BACSU
49 PsiBlast_CBE 87.9696% -91 - C7 -2FC2 11.7 NOSO_BACSU
17 PsiBlast_PDB 87.9599% -86 - C7 -4UG9 12.0 NOSO_BACSU
7 PsiBlast_PDB 87.8699% -85 - C7 -4D3J 11.8 NOSO_BACSU
39 PsiBlast_CBE 87.7699% -86 - C7 -4UGE 11.7 NOSO_BACSU
2 PsiBlast_PDB 87.7599% -85 - C7 -4LWA 11.8 NOSO_BACSU
43 PsiBlast_CBE 87.7499% -86 - C7 -4D3K 12.0 NOSO_BACSU
115 HHSearch 87.6699% -83 - C7 -4D3T 3.3 NOSO_BACSU
23 PsiBlast_CBE 87.6799% -86 - C7 -4UGU 12.0 NOSO_BACSU
48 PsiBlast_CBE 87.6696% -93 - C7 -2FC2 11.5 NOSO_BACSU
29 PsiBlast_CBE 87.6699% -85 - C7 -4UGO 11.8 NOSO_BACSU
40 PsiBlast_CBE 87.6599% -85 - C7 -4UGD 11.8 NOSO_BACSU
28 PsiBlast_CBE 87.6099% -83 - C7 -4UGP 12.1 NOSO_BACSU
32 PsiBlast_CBE 87.5499% -85 - C7 -4UGL 11.8 NOSO_BACSU
12 PsiBlast_PDB 87.5299% -83 - C7 -4D3T 12.0 NOSO_BACSU
22 PsiBlast_CBE 87.4399% -85 - C7 -4UGX 11.8 NOSO_BACSU
20 PsiBlast_PDB 87.4399% -83 - C7 -4UGC 11.8 NOSO_BACSU
27 PsiBlast_CBE 87.4299% -85 - C7 -4UGQ 12.0 NOSO_BACSU
33 PsiBlast_CBE 87.3999% -82 - C7 -4UGK 11.9 NOSO_BACSU
35 PsiBlast_CBE 87.3599% -87 - C7 -4UGI 12.0 NOSO_BACSU
30 PsiBlast_CBE 87.3199% -84 - C7 -4UGN 11.9 NOSO_BACSU
19 PsiBlast_PDB 87.3099% -85 - C7 -4UGB 11.8 NOSO_BACSU
15 PsiBlast_PDB 87.3099% -85 - C7 -4UG7 11.6 NOSO_BACSU
4 PsiBlast_PDB 87.3099% -83 - C7 -4UQR 11.8 NOSO_BACSU
18 PsiBlast_PDB 87.2899% -84 - C7 -4UGA 11.8 NOSO_BACSU
3 PsiBlast_PDB 87.2799% -84 - C7 -4LWB 11.8 NOSO_BACSU
8 PsiBlast_PDB 87.2699% -84 - C7 -4D3K 12.0 NOSO_BACSU
44 PsiBlast_CBE 87.2498% -85 - C7 -4D7I 11.8 NOSO_BACSU
21 PsiBlast_CBE 87.2199% -82 - C7 -4UGY 12.0 NOSO_BACSU
42 PsiBlast_CBE 87.1999% -85 - C7 -4D7H 12.0 NOSO_BACSU
11 PsiBlast_PDB 87.1999% -85 - C7 -4D3O 12.2 NOSO_BACSU
6 PsiBlast_PDB 87.1799% -83 - C7 -4D3I 11.9 NOSO_BACSU
34 PsiBlast_CBE 87.1699% -83 - C7 -4UGJ 11.9 NOSO_BACSU
5 PsiBlast_PDB 87.1499% -85 - C7 -4UQS 10.9 NOSO_BACSU
16 PsiBlast_PDB 87.1199% -85 - C7 -4UG8 11.9 NOSO_BACSU
13 PsiBlast_PDB 87.1099% -88 - C7 -4UG5 11.6 NOSO_BACSU
9 PsiBlast_PDB 87.0899% -84 - C7 -4D3M 11.9 NOSO_BACSU
47 PsiBlast_CBE 87.0698% -86 - C7 -4D3U 12.0 NOSO_BACSU
46 PsiBlast_CBE 87.0398% -85 - C7 -4UGV 11.8 NOSO_BACSU
24 PsiBlast_CBE 86.9599% -86 - C7 -4UGT 11.8 NOSO_BACSU
36 PsiBlast_CBE 86.9399% -82 - C7 -4UGH 11.9 NOSO_BACSU
31 PsiBlast_CBE 86.9299% -84 - C7 -4UGM 11.9 NOSO_BACSU
10 PsiBlast_PDB 86.9199% -81 - C7 -4D3N 11.9 NOSO_BACSU
41 PsiBlast_CBE 86.9099% -83 - C7 -4D7J 11.6 NOSO_BACSU
38 PsiBlast_CBE 86.7699% -84 - C7 -4UGF 11.5 NOSO_BACSU
26 PsiBlast_CBE 86.7699% -83 - C7 -4UGR 12.0 NOSO_BACSU
1 PsiBlast_PDB 86.6898% -84 - C7 -4D3V 12.1 NOSO_BACSU
37 PsiBlast_CBE 86.6699% -83 - C7 -4UGG 11.6 NOSO_BACSU
45 PsiBlast_CBE 86.5598% -83 - C7 -4UGW 11.4 NOSO_BACSU
25 PsiBlast_CBE 86.4999% -82 - C7 -4UGS 11.8 NOSO_BACSU
51 PsiBlast_CBE 86.3696% -92 - C7 -1M7V 12.0 NOSO_BACSU
55 PsiBlast_CBE 86.2295% -91 - C7 -1M7Z 11.8 NOSO_BACSU
54 PsiBlast_CBE 86.0795% -89 - C7 -2FC1 11.9 NOSO_BACSU
50 PsiBlast_CBE 85.8496% -87 - C7 -2FBZ 11.7 NOSO_BACSU
53 PsiBlast_CBE 85.7195% -92 - C7 -2AMO 11.3 NOSO_BACSU
57 PsiBlast_CBE 85.6194% -91 - C7 -2AN0 11.4 NOSO_BACSU
56 PsiBlast_CBE 85.2494% -90 - C7 -2AN2 11.6 NOSO_BACSU
52 PsiBlast_CBE 81.1695% -75 - C7 -2AMO 11.7 NOSO_BACSU
59 PsiBlast_CBE 80.6564%-110 - C7 -2FLQ 11.5 ?
58 PsiBlast_CBE 80.0964%-115 - C7 -2FLQ 11.8 ?
75 PsiBlast_CBE 76.3143%-110 - C7 -5ADF 11.9 NOS1_HUMAN
94 PsiBlast_CBE 76.2842%-106 - C7 -3JX5 11.4 NOS1_RAT
82 PsiBlast_CBE 76.2842%-106 - C7 -1ZZQ 11.9 NOS1_RAT
76 PsiBlast_CBE 76.1643%-109 - C7 -4UH6 11.7 NOS1_HUMAN
83 PsiBlast_CBE 76.0842%-108 - C7 -1ZZU 12.0 NOS1_RAT
84 PsiBlast_CBE 76.0342%-107 - C7 -1ZZR 12.0 NOS1_RAT
73 PsiBlast_CBE 76.0143%-108 - C7 -5ADG 11.7 NOS1_HUMAN
72 PsiBlast_CBE 75.9643%-109 - C7 -5ADG 11.8 NOS1_HUMAN
117 HHSearch 75.9354%-101 - C7 -1MJT 2.5 NOSO_STAAU
100 PsiBlast_CBE 75.8442%-104 - C7 -1P6K 11.6 NOS1_RAT
81 PsiBlast_CBE 75.8443%-105 - C7 -4UCH 11.6 NOS1_HUMAN
88 PsiBlast_CBE 75.8242%-105 - C7 -4CX3 11.2 NOS1_RAT
87 PsiBlast_CBE 75.7642%-105 - C7 -4CX4 11.4 NOS1_RAT
80 PsiBlast_CBE 75.6943%-103 - C7 -4UCH 11.8 NOS1_HUMAN
79 PsiBlast_CBE 75.6943%-107 - C7 -4UH5 11.9 NOS1_HUMAN
77 PsiBlast_CBE 75.6543%-106 - C7 -4UH6 11.6 NOS1_HUMAN
86 PsiBlast_CBE 75.6442%-104 - C7 -5ADD 11.5 NOS1_RAT
93 PsiBlast_CBE 75.6242%-104 - C7 -3N61 11.8 NOS1_RAT
74 PsiBlast_CBE 75.5443%-107 - C7 -5ADF 11.7 NOS1_HUMAN
96 PsiBlast_CBE 75.4642%-103 - C7 -3JX3 11.4 NOS1_RAT
91 PsiBlast_CBE 75.4642%-101 - C7 -3NLP 11.4 NOS1_RAT
92 PsiBlast_CBE 75.4442%-104 - C7 -3N63 12.0 NOS1_RAT
70 PsiBlast_CBE 75.3943%-106 - C7 -5ADI 11.7 NOS1_HUMAN
99 PsiBlast_CBE 75.3542%-104 - C7 -3DQR 11.4 NOS1_RAT
97 PsiBlast_CBE 75.3542%-103 - C7 -3JX2 11.4 NOS1_RAT
61 PsiBlast_CBE 75.3553% -99 - C7 -1MJT 2.5 NOSO_STAAU
71 PsiBlast_CBE 75.3043%-108 - C7 -5ADI 11.8 NOS1_HUMAN
78 PsiBlast_CBE 75.2643%-106 - C7 -4UH5 11.8 NOS1_HUMAN
95 PsiBlast_CBE 75.1442%-105 - C7 -3JX4 10.1 NOS1_RAT
98 PsiBlast_CBE 75.0542%-103 - C7 -3JX2 11.6 NOS1_RAT
85 PsiBlast_CBE 74.9542%-102 - C7 -5ADE 11.2 NOS1_RAT
89 PsiBlast_CBE 74.9442%-104 - C7 -3NLR 11.3 NOS1_RAT
90 PsiBlast_CBE 74.3742%-101 - C7 -3NLQ 10.2 NOS1_RAT
60 PsiBlast_CBE 74.3653%-101 - C7 -1MJT 2.6 NOSO_STAAU