@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu07640: (2016-06-12 )
MLQYRIIVDGRVQGVGFRYFVQMEADKRKLAGWVKNRDDGRVEILAEGPENALQSFVEAVKNGSPFSKVTDISVTESRSLEGHHRFSIVYS

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FMT_A_4(1W2I)
ACYP_PYRHO
[Raw transfer]




GOL_A_3(3BR8)
ACYP_BACSU
[Raw transfer]




FMT_A_3(1W2I)
ACYP_PYRHO
[Raw transfer]




4 PsiBlast_PDB 80.78100%-113 - C5 -3BR8 2.5 ACYP_BACSU
2 PsiBlast_PDB 78.87100% -99 - C5 -2HLT - ACYP_BACSU -
3 PsiBlast_PDB 76.33100% -88 - C5 -2HLU - ACYP_BACSU -
66 HHSearch 74.16100% -79 - C5 -2FHM - ACYP_BACSU -
1 PsiBlast_PDB 74.16100% -79 - C5 -2FHM - ACYP_BACSU -
69 HHSearch 60.6537%-103 - C5 -2BJD - ACYP_SULSO -
18 PsiBlast_PDB 57.5439% -99 - C5 -3TNV - ACYP_PYRHO -
48 PsiBlast_CBE 56.9938%-137 - C5 -3VTH - ? -
75 HHSearch 56.8436%-117 - C5 -3VTH - ? -
71 HHSearch 56.5438% -98 - C5 -1W2I 3.6 ACYP_PYRHO
13 PsiBlast_PDB 55.3441% -88 - C5 -2W4D - ACYP_PYRHO -
40 PsiBlast_CBE 55.1731%-113 - C5 -4HI1 - ACYP_VIBC3 -
30 PsiBlast_CBE 54.9241% -84 - C5 -2W4D - ACYP_PYRHO -
34 PsiBlast_CBE 54.8746%-119 - C5 -4OJG - ACYP_SULSO -
64 HHSearch 54.7739%-104 * C5 *1ULR - ACYP_THET8 -
42 PsiBlast_CBE 54.5831%-100 - C5 -4HI1 - ACYP_VIBC3 -
28 PsiBlast_CBE 54.2041% -90 - C5 -2W4D - ACYP_PYRHO -
15 PsiBlast_PDB 53.8541% -84 - C5 -1V3Z - ACYP_PYRHO -
27 PsiBlast_CBE 53.8041% -87 - C5 -2W4D - ACYP_PYRHO -
29 PsiBlast_CBE 53.5041% -86 - C5 -2W4D - ACYP_PYRHO -