@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu07880: (2016-06-12 )
MISVLFVCLGNICRSPMAEAIFRDLAAKKGLEGKIKADSAGIGGWHIGNPPHEGTQEILRREGISFDGMLARQVSEQDLDDFDYIIAMDAENIGSLRSMAGFKNTSHIKRLLDYVEDSDLADVPDPYYTGNFEEVCQLIKTGCEQLLASIQKEKQL

Atome Classification :

(30 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

MPO_A_5(4LRQ)
?
[Raw transfer]




MPO_C_11(4LRQ)
?
[Raw transfer]




MPO_A_5(4LRQ)
?
[Raw transfer]




EPE_A_3(3JS5)
?
[Raw transfer]




MPO_B_8(4LRQ)
?
[Raw transfer]




MPO_D_14(4LRQ)
?
[Raw transfer]




EPE_B_4(3IDO)
?
[Raw transfer]




EPE_A_3(3IDO)
?
[Raw transfer]




4NP_D_4(1D1Q)
PPAL_YEAST
[Raw transfer]




PMS_A_5(4Z9A)
PPAC_HUMAN
[Raw transfer]




EPE_B_2(1DG9)
PPAC_BOVIN
[Raw transfer]




MES_B_2(5PNT)
PPAC_HUMAN
[Raw transfer]




B85_A_2(4Z9B)
PPAC_HUMAN
[Raw transfer]




4NP_D_4(1D1Q)
PPAL_YEAST
[Raw transfer]




GOL_A_3(1U2Q)
PTPA_MYCTU
[Raw transfer]




EPE_C_3(1D1P)
PPAL_YEAST
[Raw transfer]




EPE_D_4(1D1P)
PPAL_YEAST
[Raw transfer]




CHAIN_B_2(3ROF)
PTPA_STAAU
[Raw transfer]

-

CHAIN_B_2(3ROF)
PTPA_STAAU
[Raw transfer]

-

1 PsiBlast_PDB 94.42100%-139 - C6 -4ETM - YFKJ_BACSU -
21 PsiBlast_CBE 93.55100%-141 - C6 -4ETM - YFKJ_BACSU -
66 HHSearch 92.6399%-140 - C6 -4ETM - YFKJ_BACSU -
33 PsiBlast_CBE 70.6833%-121 - C6 -3IDO 4.8 ?
2 PsiBlast_PDB 70.6845%-124 - C6 -3ROF 3.8 PTPA_STAAU
32 PsiBlast_CBE 70.4333%-123 - C6 -3JS5 4.5 ?
19 PsiBlast_PDB 70.3233%-125 - C6 -3IDO 4.6 ?
34 PsiBlast_CBE 70.2133%-123 - C6 -3JVI - ? -
3 PsiBlast_PDB 70.1738%-107 - C6 -4LRQ 4.9 ?
65 HHSearch 69.3237%-106 - C6 -4LRQ 4.9 ?
63 HHSearch 68.8533%-121 - C6 -3JVI - ? -
24 PsiBlast_CBE 68.6938%-105 - C6 -4LRQ 5.0 ?
23 PsiBlast_CBE 68.6538%-103 - C6 -4LRQ 5.2 ?
26 PsiBlast_CBE 68.3839%-135 - C6 -2CWD - ? -
67 HHSearch 68.3745%-127 - C6 -3ROF 3.8 PTPA_STAAU
25 PsiBlast_CBE 68.0539%-136 - C6 -2CWD - ? -
27 PsiBlast_CBE 66.7939%-132 - C6 -2CWD - ? -
38 PsiBlast_CBE 66.7533% -95 - C6 -1D2A - PPAL_YEAST -
64 HHSearch 66.7138%-124 - C6 -3N8I - PPAC_HUMAN -
10 PsiBlast_PDB 66.5839%-138 - C6 -2CWD - ? -
69 HHSearch 66.0232%-105 - C6 -1D1Q 4.6 PPAL_YEAST
8 PsiBlast_PDB 65.9039%-126 - C6 -5PNT 2.8 PPAC_HUMAN
37 PsiBlast_CBE 65.8434%-103 - C6 -1D1P 2.6 PPAL_YEAST
22 PsiBlast_CBE 65.7038%-101 - C6 -4LRQ 5.1 ?
41 PsiBlast_CBE 65.4733% -98 - C6 -1D1Q 3.7 PPAL_YEAST
12 PsiBlast_PDB 65.3637%-118 - C6 -1DG9 4.7 PPAC_BOVIN
6 PsiBlast_PDB 65.2839%-123 - C6 -4Z9A 2.8 PPAC_HUMAN
36 PsiBlast_CBE 65.0034%-105 - C6 -1D1P 2.7 PPAL_YEAST
7 PsiBlast_PDB 62.6239%-122 - C6 -4Z9B 3.4 PPAC_HUMAN
42 PsiBlast_CBE 60.8535%-116 - C6 -1U2Q 2.4 PTPA_MYCTU