@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu07990: (2016-06-12 )
MKIAVIGLGNMGQPIARNVLQAGYELTVYNRTKQKTEDLVTEGAQAADTPRLAAKSADIVITMLADDDSVSTVTFGEDGLLEGLAENGIHISMSTISVEFSEKLAAAHAEKGQFFLAAPVLGRPDAAAKAALRIITAGPAEAKQAAKPLLDSLSQQIFDVGEESKTANAAKISINFLLVSMLEALSESFLMMEKYGLEQKQFLEIASALFGSPVYQNYGTIMAEQKFEPAGFKMSLGLKDTNLALAAAKRVSANLPLAELAKSHFESGIEKGFGDLDWAALIKCIK

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EPE_A_6(3OBB)
SERDH_PSEAE
[Raw transfer]




NAP_A_2(3WS7)
?
[Raw transfer]




EDO_A_5(3OBB)
SERDH_PSEAE
[Raw transfer]




74 HHSearch 88.9740%-128 - C1 -4GBJ - ? -
1 PsiBlast_PDB 87.9640%-131 - C1 -4GBJ - ? -
83 HHSearch 82.2331%-126 - C1 -3WS7 11.7 ?
6 PsiBlast_PDB 82.1431%-130 - C1 -3W6Z - ? -
70 HHSearch 81.1533%-125 - C1 -3OBB 3.1 SERDH_PSEAE
66 HHSearch 81.0631%-108 - C1 -3PDU - ? -
3 PsiBlast_PDB 80.4832%-106 - C1 -3PEF - ? -
5 PsiBlast_PDB 80.2431%-127 - C1 -3WS7 - ? -
71 HHSearch 79.8429%-109 - C1 -1VPD - ? -
2 PsiBlast_PDB 79.6932% -98 - C1 -3DOJ - GLYR1_ARATH -
67 HHSearch 79.6531%-105 - C1 -3PEF - ? -
21 PsiBlast_CBE 79.3532%-100 - C1 -3PDU - ? -
23 PsiBlast_CBE 79.1232%-101 - C1 -3PDU - ? -
86 Fugue 78.9331% -98 * C1 *3DOJ - GLYR1_ARATH -
26 PsiBlast_CBE 78.9332%-101 - C1 -3PDU - ? -
22 PsiBlast_CBE 78.8932%-100 - C1 -3PDU - ? -
85 HHSearch 78.8630%-101 - C1 -4DLL - ? -
25 PsiBlast_CBE 78.8632% -99 - C1 -3PDU - ? -
27 PsiBlast_CBE 78.7832%-100 - C1 -3PDU - ? -
4 PsiBlast_PDB 78.6632%-100 - C1 -3PDU - ? -
13 PsiBlast_PDB 77.3932%-116 - C1 -3OBB 1.6 SERDH_PSEAE