@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu08480: (2016-06-13 )
MPQTEQIHQHSVLRDIIRSRRSIRKFKQEPVPSAVILDMLETAKYAPNHRVTEPWRFIYVSSETGKANLINTFAAFSKKSKPDMTEEKLQNFKNTLGRVPGFLLVVFQEDENERARDDDFAATSSLIQNLQLLAWEKGIGMVWKSGKILYDKEVHQAFGLQDNERFAAIIQTGYPDEAPEVKKRTPIRDRFTEM

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FMN_B_15(2I7H)
?
[Raw transfer]




FMN_B_15(2I7H)
?
[Raw transfer]




118 HHSearch 88.9233%-123 - C2 -2I7H 4.2 ?
1 PsiBlast_PDB 85.5234%-124 - C2 -2I7H 4.2 ?
105 HHSearch 78.6821%-125 - C2 -3EO8 - ? -
107 HHSearch 77.3723%-137 - C2 -1NOX - NOX_THET8 -
121 HHSearch 75.1122%-118 - C2 -3GE6 - ? -
8 PsiBlast_PDB 74.8326%-111 - C2 -3EK3 - ? -
15 PsiBlast_PDB 74.7222%-133 - C2 -4XOQ - ? -
18 PsiBlast_PDB 74.6823%-127 - C2 -3GH8 - IYD1_MOUSE -
102 HHSearch 74.4219%-113 - C2 -3K6H - ? -
117 HHSearch 73.6820%-122 - C2 -4XOM - ? -
17 PsiBlast_PDB 73.6623%-121 - C2 -3GFD - IYD1_MOUSE -
120 HHSearch 73.2218%-129 - C2 -2HAY - ? -
13 PsiBlast_PDB 73.1422%-138 - C2 -4XOM - ? -
14 PsiBlast_PDB 73.0422%-128 - C2 -4XOO - ? -
12 PsiBlast_PDB 72.8423%-131 - C2 -4TTC - IYD1_HUMAN -
119 HHSearch 72.5523%-135 - C2 -3E39 - ? -
4 PsiBlast_PDB 72.4725%-103 - C2 -4DN2 - ? -
115 HHSearch 71.8319%-114 - C2 -3GBH - ? -
16 PsiBlast_PDB 71.4023%-150 - C2 -3GB5 - IYD1_MOUSE -
9 PsiBlast_PDB 71.0226%-121 - C2 -3E10 - ? -