@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu09130: (2016-06-14 )
METLLVVLHVFILFLLILGLFVMQKKHVSFSKRVFTALGLGIVFGFALQLIYGPTSNIVIQTADWFNIAGGGYVKLLQMVVMPLVFISILGAFTKLKLTKNLGKISGLIIGILVATTAVAAAVGIASALSFDLQAIQVDQGSTELSRGQELQQKSEDMTAKTLPQQIVELLPGNPFLDFTGARPTSTIAVVIFAAFLGVAFLGVKHKQPEQAETFKKLVDAVYAIVMRVVTLILRLTPYGVLAIMTKTIATSDLDSILKLGMFVIASYAALITMFIIHLLLLTFSGLNPVIYLKKAVPVLVFAFTSRSSAGALPLNIKTQRSMGVPEGIANFAGSFGLSIGQNGCAGIYPAMLAMMIAPTVGQNPFDPVFIITVIAVVAISSFGVAGVGGGATFAALLVLSSLNMPVALAGLLISIEPLIDMGRTALNVSGSMTSGLITSKVTKEIDQGAFHDQSRVIEAEEA

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ASP_A_6(4IZM)
?
[Raw transfer]




28 Fugue 75.0326%-161 - C3 -4OYF - ? -
2 PsiBlast_PDB 74.9127%-154 - C3 -4KY0 - ? -
18 HHSearch 74.6925%-164 - C3 -2NWL - ? -
14 PsiBlast_PDB 71.5127%-159 - C3 -4IZM 4.7 ?
1 PsiBlast_PDB 71.4727%-172 - C3 -3KBC - ? -
11 PsiBlast_PDB 71.2927%-175 - C3 -4P3J - ? -
10 PsiBlast_PDB 71.2327%-172 - C3 -4P1A - ? -
12 PsiBlast_PDB 71.2227%-172 - C3 -4P6H - ? -
9 PsiBlast_PDB 71.1527%-178 - C3 -4P19 - ? -
4 PsiBlast_PDB 70.6027%-160 - C3 -2NWW - ? -
16 PsiBlast_PDB 70.5627%-172 - C3 -4X2S - ? -
13 PsiBlast_PDB 70.5127%-161 - C3 -4OYE - ? -
7 PsiBlast_PDB 70.4927%-157 - C3 -2NWL - ? -
5 PsiBlast_PDB 70.4527%-153 - C3 -2NWX - ? -
6 PsiBlast_PDB 70.2627%-164 - C3 -4OYF - ? -
27 Fugue 70.1826%-153 * C3 *1XFH - ? -
15 PsiBlast_PDB 70.0527%-173 - C3 -3V8G - ? -
8 PsiBlast_PDB 70.0427%-172 - C3 -3V8F - ? -
3 PsiBlast_PDB 69.9327%-152 - C3 -1XFH - ? -
29 Fugue 43.9918%-116 - C2 -5CUY - ? -