@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu09670: (2016-06-15 )
MKVLVNGRLIGRSEASIDLEDRGYQFGDGIYEVIRVYKGVLFGLREHAERFFRSAAEIGISLPFSIEDLEWDLQKLVQENAVSEGAVYIQTTRGVAPRKHQYEAGLEPQTTAYTFTVKKPEQEQAYGVAAITDEDLRWLRCDIKSLNLLYNVMTKQRAYEAGAFEAILLRDGVVTEGTSSNVYAVINGTVRTHPANRLILNGITRMNILGLIEKNGIKLDETPVSEEELKQAEEIFISSTTAEIIPVVTLDGQSIGSGKPGPVTKQLQAAFQESIQQAASIS

Atome Classification :

(24 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PSZ_B_4(3LQS)
DAAA_BACYM
[Raw transfer]




PSZ_A_3(3LQS)
DAAA_BACYM
[Raw transfer]




DCS_B_4(2DAA)
DAAA_BACYM
[Raw transfer]




DCS_A_3(2DAA)
DAAA_BACYM
[Raw transfer]




PMP_B_4(1A0G)
DAAA_BACYM
[Raw transfer]




PLP_B_4(1DAA)
DAAA_BACYM
[Raw transfer]




PLP_A_3(2DAB)
DAAA_BACYM
[Raw transfer]




PLP_A_3(1DAA)
DAAA_BACYM
[Raw transfer]




PDD_B_4(3DAA)
DAAA_BACYM
[Raw transfer]




PMP_A_3(1A0G)
DAAA_BACYM
[Raw transfer]




PLP_A_5(4DAA)
DAAA_BACYM
[Raw transfer]




PDD_A_3(3DAA)
DAAA_BACYM
[Raw transfer]




PDD_A_3(3DAA)
DAAA_BACYM
[Raw transfer]




PLP_B_6(4DAA)
DAAA_BACYM
[Raw transfer]




PLP_A_5(1G2W)
DAAA_BACYM
[Raw transfer]




PLP_B_6(1G2W)
DAAA_BACYM
[Raw transfer]




PLP_B_4(5DAA)
DAAA_BACYM
[Raw transfer]




PLP_B_4(2DAB)
DAAA_BACYM
[Raw transfer]




PLP_A_3(5DAA)
DAAA_BACYM
[Raw transfer]




PLP_A_3(5DAA)
DAAA_BACYM
[Raw transfer]




ACY_B_5(3LQS)
DAAA_BACYM
[Raw transfer]




4MV_A_5(2EIY)
?
[Raw transfer]




12 PsiBlast_PDB 89.2541% -87 - C- -4TM5 - ? -
31 PsiBlast_CBE 88.8341% -93 - C8 -4M0J - ? -
11 PsiBlast_PDB 88.4841% -90 - C8 -4M0J - ? -
8 PsiBlast_PDB 88.4443% -67 - C8 -2DAB 5.4 DAAA_BACYM
4 PsiBlast_PDB 88.4044% -76 - C8 -4DAA 3.9 DAAA_BACYM
28 PsiBlast_CBE 88.1043% -72 - C8 -1A0G 4.9 DAAA_BACYM
7 PsiBlast_PDB 87.9143% -68 - C8 -1A0G 5.9 DAAA_BACYM
29 PsiBlast_CBE 87.6543% -76 - C8 -5DAA 4.2 DAAA_BACYM
27 PsiBlast_CBE 87.5543% -69 - C8 -2DAB 4.7 DAAA_BACYM
25 PsiBlast_CBE 87.4544% -72 - C8 -3LQS 6.2 DAAA_BACYM
21 PsiBlast_CBE 87.4443% -75 - C8 -2DAA 6.9 DAAA_BACYM
48 HHSearch 87.3240% -81 - C- -4TM5 - ? -
26 PsiBlast_CBE 87.1343% -75 - C8 -1G2W 4.3 DAAA_BACYM
6 PsiBlast_PDB 86.8043% -75 - C8 -1G2W 3.9 DAAA_BACYM
1 PsiBlast_PDB 86.7543% -74 - C8 -1DAA 6.1 DAAA_BACYM
23 PsiBlast_CBE 86.7044% -73 - C8 -4DAA 4.1 DAAA_BACYM
24 PsiBlast_CBE 86.6544% -75 - C8 -3DAA 6.1 DAAA_BACYM
5 PsiBlast_PDB 86.5344% -72 - C8 -3LQS 6.2 DAAA_BACYM
22 PsiBlast_CBE 86.5243% -74 - C8 -1DAA 5.3 DAAA_BACYM
2 PsiBlast_PDB 86.4743% -73 - C8 -2DAA 6.9 DAAA_BACYM
9 PsiBlast_PDB 86.0743% -76 - C8 -5DAA 4.0 DAAA_BACYM
3 PsiBlast_PDB 86.0644% -72 - C8 -3DAA 6.1 DAAA_BACYM
32 Fugue 85.4942% -74 - C8 -5DAA 4.0 DAAA_BACYM
43 HHSearch 84.4244% -68 * C8 *3DAA 6.1 DAAA_BACYM