@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu09890: (2016-06-15 )
MLTIDHVTKTFGDYKAVDGLDLDIPEQQMFGLLGANGAGKTTTFRMILGLLSITEGSISWKGRPVNYHISNKIGYLPEERGLYPKMKVRDQLVYLARLKGMEKREAVKELGTWLERFNITDYENKKVEELSKGNQQKIQFISAVLHKPELLILDEPFSGLDPVNVELLKEAVISLKNSGVSILFSSHRMEHVEELCENLCILQKGKPVVQGKLKEIKRSFGKKNVTIHSDDDLRFLQSHEGILQWKETADGVKLQIANEDISQEIFAMLQGKGFIRKFELEEPSLHDIFIEKVGAVYE

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_A_3(4QC2)
?
[Raw transfer]




ADP_A_3(4P31)
LPTB_ECOLI
[Raw transfer]




ATP_A_2(1JI0)
?
[Raw transfer]




POP_A_9(2D62)
?
[Raw transfer]




ADP_A_3(4YER)
?
[Raw transfer]




21 HHSearch 81.6627%-123 - C1 -4YER - ? -
8 PsiBlast_PDB 80.2526%-122 - C1 -4YER 6.0 ?
5 PsiBlast_PDB 78.5531%-131 - C1 -1VPL - ? -
39 HHSearch 76.2030%-142 - C1 -4RVC - ? -
1 PsiBlast_PDB 74.8831%-136 - C1 -4RVC - ? -
4 PsiBlast_PDB 71.2428%-119 - C1 -4P33 - LPTB_ECOLI -
3 PsiBlast_PDB 70.4528%-113 - C1 -4QC2 6.9 ?
30 HHSearch 70.4130%-124 - C1 -1OXX - ? -
13 PsiBlast_PDB 69.7728%-137 - C1 -1JI0 5.0 ?
6 PsiBlast_PDB 69.0028%-115 - C1 -4P31 6.4 LPTB_ECOLI
35 HHSearch 68.9624%-131 - C1 -4FWI - ? -
7 PsiBlast_PDB 68.2327%-137 - C1 -4WBS - ? -
23 HHSearch 67.9428%-118 - C1 -1Z47 - ? -
31 HHSearch 67.5525%-132 * C1 *3TUI - METN_ECOLI -
2 PsiBlast_PDB 67.4428%-117 - C1 -4P32 - LPTB_ECOLI -
44 Fugue 67.1527% -98 - C1 -1OXS - ? -
20 PsiBlast_PDB 66.9927%-125 - C1 -4U00 - ? -
18 PsiBlast_PDB 66.9929%-123 - C1 -1OXV - ? -
15 PsiBlast_PDB 66.5429%-121 - C1 -1OXS - ? -
17 PsiBlast_PDB 66.5029%-126 - C1 -1OXU - ? -