@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu09950: (2016-06-15 )
MKKIAIAAITATSILALSACSSGDKEVIAKTDAGDVTKGELYTNMKKTAGASVLTQLVQEKVLDKKYKVSDKEIDNKLKEYKTQLGDQYTALEKQYGKDYLKEQVKYELLTQKAAKDNIKVTDADIKEYWEGLKGKIRASHILVADKKTAEEVEKKLKKGEKFEDLAKEYSTDSSASKGGDLGWFAKEGQMDETFSKAAFKLKTGEVSDPVKTQYGYHIIKKTEERGKYDDMKKELKSEVLEQKLNDNAAVQEAVQKVMKKADIEVKDKDLKDTFNTSSTSNSTSSSSSNSK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ICB_A_3(5EZ1)
?
[Raw transfer]




1 PsiBlast_PDB 88.7797% -35 - C5 -4WO7 - PRSA_BACSU -
48 HHSearch 88.5697% -40 - C5 -4WO7 - PRSA_BACSU -
3 PsiBlast_PDB 72.0543% -46 - C5 -5HTF - ? -
52 HHSearch 63.2628% -73 - C5 -3RFW - CBF2_CAMJE -
2 PsiBlast_PDB 60.63100% -19 - C5 -1ZK6 - PRSA_BACSU -
53 HHSearch 59.1522% -73 - C3 -1M5Y - SURA_ECOLI -
7 PsiBlast_PDB 58.8937% -62 - C5 -3RFW - CBF2_CAMJE -
37 PsiBlast_CBE 57.9235% -95 - C5 -5EZ1 - ? -
50 HHSearch 57.6326% -50 - C5 -5EZ1 3.1 ?
39 Fugue 57.0425% -54 - C5 -3RFW - CBF2_CAMJE -
41 Fugue 56.4744% -86 - C5 -1PIN - PIN1_HUMAN -
57 HHSearch 56.3045% -90 * C5 *4TNS - -
26 PsiBlast_CBE 56.1739% -57 - C5 -3KAC - PIN1_HUMAN -
12 PsiBlast_PDB 55.9539% -64 - C5 -3IKG - PIN1_HUMAN -
14 PsiBlast_PDB 55.6839% -60 - C5 -3I6C - PIN1_HUMAN -
36 PsiBlast_CBE 55.4735% -76 - C5 -5EZ1 - ? -
49 HHSearch 55.4515% -63 * C4 *3NRK - ? -
62 HHSearch 55.4041% -87 - C5 -3UI4 - PIN4_HUMAN -
29 PsiBlast_CBE 55.2939% -56 - C5 -2ZR4 - PIN1_HUMAN -
21 PsiBlast_CBE 55.1439% -61 - C5 -4TYO - ? -