@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu10020: (2016-06-15 )
MERTTNFNAGPAALPLEVLQKAQKEFIDFNESGMSVMELSHRSKEYEAVHQKAKSLLIELMGIPEDYDILFLQGGASLQFSMLPMNFLTPEKTAHFVMTGAWSEKALAETKLFGNTSITATSETDNYSYIPEVDLTDVKDGAYLHITSNNTIFGTQWQEFPNSPIPLVADMSSDILSRKIDVSKFDVIYGGAQKNLGPSGVTVVIMKKSWLQNENANVPKILKYSTHVKADSLYNTPPTFAIYMLSLVLEWLKENGGVEAVEQRNEQKAQVLYSCIDESNGFYKGHARKDSRSRMNVTFTLRDDELTKTFVQKAKDAKMIGLGGHRSVGGCRASIYNAVSLEDCEKLAAFMKKFQQENE

Atome Classification :

(38 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PLP_B_4(3QBO)
?
[Raw transfer]




PLP_B_11(2BIA)
SERC_BACAO
[Raw transfer]




PLP_B_11(2BI3)
SERC_BACAO
[Raw transfer]




PLP_B_11(2BI5)
SERC_BACAO
[Raw transfer]




PLP_B_11(2BI2)
SERC_BACAO
[Raw transfer]




PLP_B_11(2BI9)
SERC_BACAO
[Raw transfer]




PLP_A_10(1W23)
SERC_BACAO
[Raw transfer]




PLP_B_18(1W23)
SERC_BACAO
[Raw transfer]




PLP_A_10(1W23)
SERC_BACAO
[Raw transfer]




PLP_A_3(2BI5)
SERC_BACAO
[Raw transfer]




PLP_A_3(2C0R)
SERC_BACCI
[Raw transfer]




PLP_A_3(1BT4)
SERC_BACCI
[Raw transfer]




PLP_A_3(2BIA)
SERC_BACAO
[Raw transfer]




PLP_A_3(2BI9)
SERC_BACAO
[Raw transfer]




PLP_A_3(1BT4)
SERC_BACCI
[Raw transfer]




PLP_A_3(2BIG)
SERC_BACAO
[Raw transfer]




PLP_A_3(2BI2)
SERC_BACAO
[Raw transfer]




PLP_A_3(2C0R)
SERC_BACCI
[Raw transfer]




PLP_B_5(4AZK)
SERC_BACAO
[Raw transfer]




PLP_B_4(2C0R)
SERC_BACCI
[Raw transfer]




PLP_A_2(1W3U)
SERC_BACCI
[Raw transfer]




PLP_A_3(4AZK)
SERC_BACAO
[Raw transfer]




PLP_B_10(2BIE)
SERC_BACAO
[Raw transfer]




PLP_A_4(3E77)
SERC_HUMAN
[Raw transfer]




PLP_A_4(3E77)
SERC_HUMAN
[Raw transfer]




PLP_B_11(2BI1)
SERC_BACAO
[Raw transfer]




PLP_B_11(2BHX)
SERC_BACAO
[Raw transfer]




PLP_B_6(3E77)
SERC_HUMAN
[Raw transfer]




PLP_A_3(2BI1)
SERC_BACAO
[Raw transfer]




PLP_A_3(2BHX)
SERC_BACAO
[Raw transfer]




PLP_A_3(2BI3)
SERC_BACAO
[Raw transfer]




PLP_A_3(2BIE)
SERC_BACAO
[Raw transfer]




PLP_B_10(2BIG)
SERC_BACAO
[Raw transfer]




PLP_A_3(3QBO)
?
[Raw transfer]




MES_A_4(3M5U)
SERC_CAMJE
[Raw transfer]




MES_A_4(3M5U)
SERC_CAMJE
[Raw transfer]




PLP_A_3(1BJO)
SERC_ECOLI
[Raw transfer]




9 PsiBlast_PDB 100.0059% 0 - C- -4AZJ - SERC_BACAO -
23 PsiBlast_CBE 94.3359%-107 - C1 -2BIA 3.9 SERC_BACAO
1 PsiBlast_PDB 94.2859%-103 - C1 -1W23 3.9 SERC_BACAO
27 PsiBlast_CBE 94.1559%-108 - C1 -2BI2 4.7 SERC_BACAO
26 PsiBlast_CBE 94.0859%-108 - C1 -2BI3 4.6 SERC_BACAO
25 PsiBlast_CBE 93.8959%-107 - C1 -2BI5 4.8 SERC_BACAO
24 PsiBlast_CBE 93.7159%-107 - C1 -2BI9 4.9 SERC_BACAO
28 PsiBlast_CBE 93.4159%-106 - C1 -2BI1 4.5 SERC_BACAO
39 HHSearch 93.3159%-104 - C1 -1W23 3.9 SERC_BACAO
4 PsiBlast_PDB 93.3059%-103 - C1 -2BI2 4.6 SERC_BACAO
8 PsiBlast_PDB 93.1959%-103 - C1 -2BIA 4.7 SERC_BACAO
7 PsiBlast_PDB 93.1059%-102 - C1 -2BI9 4.8 SERC_BACAO
2 PsiBlast_PDB 93.0659%-102 - C1 -2BHX 4.3 SERC_BACAO
29 PsiBlast_CBE 92.9959%-105 - C1 -2BHX 4.5 SERC_BACAO
6 PsiBlast_PDB 92.9759%-103 - C1 -2BI5 4.8 SERC_BACAO
3 PsiBlast_PDB 92.9459%-102 - C1 -2BI1 4.6 SERC_BACAO
10 PsiBlast_PDB 92.8859% -99 - C1 -4AZK 4.2 SERC_BACAO
30 PsiBlast_CBE 92.8359%-104 - C1 -1W23 3.8 SERC_BACAO
12 PsiBlast_PDB 92.5559%-103 - C1 -2BIG 4.5 SERC_BACAO
11 PsiBlast_PDB 92.2659%-102 - C1 -2BIE 4.3 SERC_BACAO
5 PsiBlast_PDB 92.2259%-101 - C1 -2BI3 4.8 SERC_BACAO
21 PsiBlast_CBE 92.1359%-102 - C1 -4AZK 4.2 SERC_BACAO
32 PsiBlast_CBE 91.9459%-104 - C1 -2BIE 4.3 SERC_BACAO
31 PsiBlast_CBE 91.8959%-103 - C1 -2BIG 3.6 SERC_BACAO
33 PsiBlast_CBE 90.9054% -95 - C1 -2C0R 4.7 SERC_BACCI
14 PsiBlast_PDB 90.8154% -98 - C1 -2C0R 4.7 SERC_BACCI
15 PsiBlast_PDB 90.5154% -98 - C1 -1BT4 3.3 SERC_BACCI
13 PsiBlast_PDB 90.3154% -98 - C1 -1W3U 4.4 SERC_BACCI
61 Fugue 89.9753%-100 * C1 *1BT4 3.3 SERC_BACCI
16 PsiBlast_PDB 87.8747% -95 - C1 -3M5U 2.1 SERC_CAMJE
18 PsiBlast_PDB 85.2843%-112 - C1 -3E77 3.5 SERC_HUMAN
34 PsiBlast_CBE 84.0643%-107 - C1 -3E77 3.9 SERC_HUMAN
42 HHSearch 83.3252% -92 - C1 -2C0R 4.7 SERC_BACCI
45 HHSearch 82.8843%-112 - C1 -3E77 3.5 SERC_HUMAN
19 PsiBlast_PDB 82.5043% -96 - C1 -1BJO 4.7 SERC_ECOLI
40 HHSearch 82.4546% -94 - C1 -3M5U 2.1 SERC_CAMJE
35 PsiBlast_CBE 81.7341% -97 - C1 -3QBO 4.5 ?
36 PsiBlast_CBE 81.6641% -95 - C1 -3QBO 3.9 ?