@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu10130: (2016-06-15 )
MSRKKMGLLVMAYGTPYKEEDIERYYTHIRRGRKPEPEMLQDLKDRYEAIGGISPLAQITEQQAHNLEQHLNEIQDEITFKAYIGLKHIEPFIEDAVAEMHKDGITEAVSIVLAPHFSTFSVQSYNKRAKEEAEKLGGLTITSVESWYDEPKFVTYWVDRVKETYASMPEDERENAMLIVSAHSLPEKIKEFGDPYPDQLHESAKLIAEGAGVSEYAVGWQSEGNTPDPWLGPDVQDLTRDLFEQKGYQAFVYVPVGFVADHLEVLYDNDYECKVVTDDIGASYYRPEMPNAKPEFIDALATVVLKKLGR

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

MP1_A_3(1C9E)
HEMH_BACSU
[Raw transfer]




H02_A_3(2Q3J)
HEMH_BACSU
[Raw transfer]




H01_A_4(2Q2N)
HEMH_BACSU
[Raw transfer]




H01_A_3(2Q2O)
HEMH_BACSU
[Raw transfer]




MMP_A_3(1C1H)
HEMH_BACSU
[Raw transfer]




CHD_A_5(4MK4)
HEMH_HUMAN
[Raw transfer]




IMD_A_7(2QD2)
HEMH_HUMAN
[Raw transfer]




IMD_A_6(3HCN)
HEMH_HUMAN
[Raw transfer]




14 PsiBlast_PDB 89.7899%-107 - C2 -2AC4 - HEMH_BACSU -
3 PsiBlast_PDB 89.60100%-102 - C2 -1N0I - HEMH_BACSU -
10 PsiBlast_PDB 89.5599%-105 - C2 -3GOQ - HEMH_BACSU -
16 PsiBlast_PDB 89.29100%-105 - C2 -1C9E 10.5 HEMH_BACSU
9 PsiBlast_PDB 89.10100%-102 - C2 -3M4Z - HEMH_BACSU -
15 PsiBlast_PDB 89.0499%-107 - C2 -2Q2O 7.9 HEMH_BACSU
2 PsiBlast_PDB 89.04100%-101 - C2 -1LD3 - HEMH_BACSU -
1 PsiBlast_PDB 88.95100%-105 - C2 -1C1H 10.2 HEMH_BACSU
8 PsiBlast_PDB 88.93100%-100 - C2 -2Q2N 8.3 HEMH_BACSU
13 PsiBlast_PDB 88.8599%-106 - C2 -2Q3J 5.9 HEMH_BACSU
4 PsiBlast_PDB 88.70100%-102 - C2 -2HK6 - HEMH_BACSU -
5 PsiBlast_PDB 88.49100%-102 - C2 -1AK1 - HEMH_BACSU -
7 PsiBlast_PDB 88.45100% -99 - C2 -1DOZ - HEMH_BACSU -
6 PsiBlast_PDB 88.4099%-100 - C2 -2H1V - HEMH_BACSU -
12 PsiBlast_PDB 88.1799% -98 - C2 -2AC2 - HEMH_BACSU -
32 HHSearch 87.1799%-100 - C2 -2H1V - HEMH_BACSU -
11 PsiBlast_PDB 86.8699% -95 - C2 -2H1W - HEMH_BACSU -
22 Fugue 84.9696%-107 - C2 -1DOZ - HEMH_BACSU -
17 PsiBlast_PDB 82.5973%-108 - C2 -2C8J - HEMH1_BACAN -
31 HHSearch 58.6826% -84 - C2 -3HCN 2.6 HEMH_HUMAN