@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu10250: (2016-06-16 )
MLFIDNQNINDPRINLAIEEYCVKHLDPEQQYLLFYVNQPSIIIGKNQNTIEEINTKYVEENGIIVVRRLSGGGAVYHDLGNLNFSFITKDDGDSFHNFKKFTEPVIQALHQLGVEAELSGRNDIVVDGRKISGNAQFATKGRIFSHGTLMFDSAIDHVVSALKVKKDKIESKGIKSIRSRVANISEFLDDKMTTEEFRSHLLRHIFNTNDVGNVPEYKLTEKDWETIHQISKERYQNWDWNYGRSPKFNLNHSKRYPVGSIDLHLEVKKGKIEDCKIFGDFFGVGDVSEIENLLVGKQYERSVIADVLEGVNLKHYFGNITKEDFLDLIY

Atome Classification :

(23 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

LAQ_A_5(2E5A)
LIPT_BOVIN
[Raw transfer]




LAQ_A_2(3A7R)
LPLA_ECOLI
[Raw transfer]




LAQ_A_2(3A7R)
LPLA_ECOLI
[Raw transfer]




ATP_A_3(2ARU)
LPLAN_THEAC
[Raw transfer]




AMP_A_6(3A7A)
LPLA_ECOLI
[Raw transfer]




AMP_C_8(3A7A)
LPLA_ECOLI
[Raw transfer]




AMP_A_4(2ART)
LPLAN_THEAC
[Raw transfer]




LPA_A_5(2C8M)
LPLAN_THEAC
[Raw transfer]




LPA_B_6(2C8M)
LPLAN_THEAC
[Raw transfer]




LPA_A_5(2C8M)
LPLAN_THEAC
[Raw transfer]




LPA_C_7(2C8M)
LPLAN_THEAC
[Raw transfer]




LPA_D_8(2C8M)
LPLAN_THEAC
[Raw transfer]




MPD_A_4(3R07)
LPLAN_THEAC
[Raw transfer]




EDO_A_11(1VQZ)
?
[Raw transfer]




37R_B_6(4TVY)
LPLA_ECOLI
[Raw transfer]




37R_B_5(4TVY)
LPLA_ECOLI
[Raw transfer]




LPA_A_4(1X2H)
LPLA_ECOLI
[Raw transfer]




EDO_A_16(1VQZ)
?
[Raw transfer]




EDO_A_16(1VQZ)
?
[Raw transfer]




38 HHSearch 82.3147% -97 - C2 -1VQZ 3.0 ?
1 PsiBlast_PDB 81.4547% -93 - C2 -1VQZ 3.0 ?
39 HHSearch 67.1732% -87 - C2 -3A7R 10.1 LPLA_ECOLI
21 PsiBlast_CBE 65.3933% -94 - C2 -4TVY 3.3 LPLA_ECOLI
6 PsiBlast_PDB 65.2233% -76 - C2 -4TVW - LPLA_ECOLI -
3 PsiBlast_PDB 65.1434% -82 - C2 -3A7R 10.0 LPLA_ECOLI
4 PsiBlast_PDB 64.1434% -85 - C2 -1X2G - LPLA_ECOLI -
24 PsiBlast_CBE 63.9633% -77 - C2 -4TVW - LPLA_ECOLI -
23 PsiBlast_CBE 63.7233% -77 - C2 -4TVW - LPLA_ECOLI -
5 PsiBlast_PDB 63.0334% -80 - C2 -1X2H 3.1 LPLA_ECOLI
22 PsiBlast_CBE 62.7633% -76 - C2 -4TVW - LPLA_ECOLI -
2 PsiBlast_PDB 62.2734% -78 - C2 -3A7A 6.3 LPLA_ECOLI
20 PsiBlast_CBE 62.1934% -69 - C2 -3A7A 5.3 LPLA_ECOLI
27 PsiBlast_CBE 60.8433%-117 - C2 -2C8M 3.5 LPLAN_THEAC
40 HHSearch 60.6626% -85 - C2 -2E5A 10.9 LIPT_BOVIN
10 PsiBlast_PDB 60.6233%-118 - C2 -2C7I - LPLAN_THEAC -
26 PsiBlast_CBE 59.9533%-115 - C2 -2C8M 3.7 LPLAN_THEAC
11 PsiBlast_PDB 59.5533%-120 - C2 -2C8M 3.8 LPLAN_THEAC
25 PsiBlast_CBE 59.3233%-114 - C2 -2C8M 3.6 LPLAN_THEAC
7 PsiBlast_PDB 59.0633%-118 - C2 -3R07 3.0 LPLAN_THEAC
41 HHSearch 58.9233%-109 * C2 *2C8M 3.8 LPLAN_THEAC
9 PsiBlast_PDB 58.3733%-107 - C2 -2ARU 6.7 LPLAN_THEAC
8 PsiBlast_PDB 58.2533%-110 - C2 -2ART 5.0 LPLAN_THEAC