@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu10800: (2016-06-17 )
MMKFFEYNWQVRDQWFTWCHQLTTEELLKNRLGGVENILYTLFHIIDVEYSWIRAIQGKEDIAVQFADYQTLNKVKSLSNTFRTEIIDVLQTHSDQIKDELVSVPWETGVLYTRDEILHHIIAHEIHHIGQLSVWARELKLSPVSASFIGRTLKPIHSY

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CIT_A_5(2QE9)
YIZA_BACSU
[Raw transfer]




CIT_A_5(2QE9)
YIZA_BACSU
[Raw transfer]




CIT_B_6(2QE9)
YIZA_BACSU
[Raw transfer]




1 PsiBlast_PDB 95.79100%-167 - C4 -2QE9 3.9 YIZA_BACSU
21 PsiBlast_CBE 94.58100%-160 - C4 -2QE9 4.0 YIZA_BACSU
40 HHSearch 94.1098%-174 - C4 -2QE9 3.9 YIZA_BACSU
41 HHSearch 60.1215%-118 - C4 -3GOR - ? -
48 HHSearch 57.6921%-116 * C4 *2OU6 - ? -
43 HHSearch 56.4415%-162 - C- -2P1A - ? -
44 HHSearch 55.4517%-116 - C4 -3DI5 - ? -
49 HHSearch 54.1212%-114 - C4 -3CEX - ? -
42 HHSearch 54.0115%-123 - C4 -3DKA - YJOA_BACSU -
53 HHSearch 53.8015%-116 - C4 -1RXQ - YFIT_BACSU -
57 HHSearch 52.9113%-133 - C4 -4X8E - EGTB_MYCTH -
59 HHSearch 52.6615%-114 - C4 -2OQM - ? -
47 HHSearch 52.3214%-123 - C4 -2RD9 - ? -
51 HHSearch 52.0413%-120 - C4 -2QNL - ? -
46 HHSearch 51.9613%-139 - C4 -2HKV - ? -
45 HHSearch 51.2610%-115 - C4 -2F22 - ? -
55 HHSearch 51.1310%-142 - C4 -5COF - ? -
56 HHSearch 49.3317%-137 - C4 -2YQY - ? -
31 Fugue 48.6714% -90 - C4 -3DKA - YJOA_BACSU -
50 HHSearch 47.637% -89 - C4 -5CIV - ? -