@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu10910: (2016-06-17 )
MTHNPNIIWHPAAISKSDRQSLNGHKSCVLWFTGLSGSGKSVLANAVDEKLYRKGIQSYVLDGDNIRHGLNKDLGFQTGDRIENIRRIGEVAKLFVDSGQMILTAFISPFREDRDMVRALFPKGEFFEIYVKCPLHVCEQRDPKGLYKKARNGEIKHFTGIDSPYEAPLSPDFIIESDQTSISDGADLIINALQNRGII

Atome Classification :

(51 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ANP_B_16(4BZX)

[Raw transfer]




ANP_C_11(3UIE)
APK1_ARATH
[Raw transfer]




PPS_B_10(2OFX)
PAPS1_HUMAN
[Raw transfer]




ANP_F_26(5CB6)
CYSC_SYNY3
[Raw transfer]




ANP_B_8(3UIE)
APK1_ARATH
[Raw transfer]




ANP_A_5(3UIE)
APK1_ARATH
[Raw transfer]




PPS_A_9(2OFX)
PAPS1_HUMAN
[Raw transfer]




ANP_A_5(3UIE)
APK1_ARATH
[Raw transfer]




ANP_A_4(4BZX)
CYSNC_MYCTU
[Raw transfer]




DAT_A_4(2PEZ)
PAPS1_HUMAN
[Raw transfer]




ADP_B_5(1X6V)
PAPS1_HUMAN
[Raw transfer]




ADX_A_3(4BZQ)
CYSNC_MYCTU
[Raw transfer]




ADP_A_3(4BZP)
?
[Raw transfer]




ADP_B_5(1X6V)
PAPS1_HUMAN
[Raw transfer]




ADP_T_20(1M7H)
KAPS_PENCH
[Raw transfer]




ADP_B_4(1XJQ)
PAPS1_HUMAN
[Raw transfer]




ADP_Q_17(1M7H)
KAPS_PENCH
[Raw transfer]




ADP_A_3(4BZP)
?
[Raw transfer]




AV2_O_15(1M7G)
KAPS_PENCH
[Raw transfer]




ADP_D_13(3CR7)
KAPS_PENCH
[Raw transfer]




ADX_B_11(5CB6)
CYSC_SYNY3
[Raw transfer]




ADX_C_8(4FXP)
APK1_ARATH
[Raw transfer]




ADX_B_7(4BZQ)

[Raw transfer]




AV2_K_11(1M7G)
KAPS_PENCH
[Raw transfer]




AV2_K_11(1M7G)
KAPS_PENCH
[Raw transfer]




ADX_D_18(5CB6)
CYSC_SYNY3
[Raw transfer]




ADX_A_3(2PEY)
PAPS1_HUMAN
[Raw transfer]




ADX_R_18(1M7G)
KAPS_PENCH
[Raw transfer]




GGZ_A_3(2PEZ)
PAPS1_HUMAN
[Raw transfer]




ADX_C_14(5CB6)
CYSC_SYNY3
[Raw transfer]




GGZ_A_3(2PEZ)
PAPS1_HUMAN
[Raw transfer]




ADP_B_4(1XNJ)
PAPS1_HUMAN
[Raw transfer]




ADP_B_8(4BZP)
?
[Raw transfer]




ADX_A_7(5CB6)
CYSC_SYNY3
[Raw transfer]




ADX_E_22(5CB6)
CYSC_SYNY3
[Raw transfer]




ADX_P_16(1M7G)
KAPS_PENCH
[Raw transfer]




ADX_A_4(4FXP)
APK1_ARATH
[Raw transfer]




ADX_B_7(5CB8)
CYSC_SYNY3
[Raw transfer]




ADX_A_3(5CB8)
CYSC_SYNY3
[Raw transfer]




ADX_A_3(5CB8)
CYSC_SYNY3
[Raw transfer]




ADX_B_6(4FXP)
APK1_ARATH
[Raw transfer]




TLA_C_3(1D6J)
KAPS_PENCH
[Raw transfer]




TLA_C_3(1D6J)
KAPS_PENCH
[Raw transfer]




34 PsiBlast_CBE 85.5148%-118 - C2 -2OFW - PAPS1_HUMAN -
11 PsiBlast_PDB 84.3553%-128 - C2 -2PEY 7.4 PAPS1_HUMAN
32 PsiBlast_CBE 83.9648%-118 - C2 -2OFW - PAPS1_HUMAN -
41 PsiBlast_CBE 83.8351%-123 - C2 -2AX4 - PAPS2_HUMAN -
36 PsiBlast_CBE 83.6548%-108 - C2 -2OFW - PAPS1_HUMAN -
12 PsiBlast_PDB 83.6353%-122 - C2 -2PEZ 7.7 PAPS1_HUMAN
40 PsiBlast_CBE 83.3351%-121 - C2 -2AX4 - PAPS2_HUMAN -
27 PsiBlast_CBE 83.1550%-109 - C2 -1M7G 8.3 KAPS_PENCH
13 PsiBlast_PDB 82.9751%-119 - C2 -2AX4 - PAPS2_HUMAN -
5 PsiBlast_PDB 82.7350%-110 - C2 -1M7H 6.8 KAPS_PENCH
10 PsiBlast_PDB 82.6548%-112 - C2 -2OFW - PAPS1_HUMAN -
24 PsiBlast_CBE 82.6453%-113 - C2 -3UIE 7.4 APK1_ARATH
8 PsiBlast_PDB 82.5347%-120 - C2 -1XJQ 7.5 PAPS1_HUMAN
28 PsiBlast_CBE 82.4748%-111 - C2 -2OFX 8.7 PAPS1_HUMAN
39 PsiBlast_CBE 82.4453%-151 - C2 -2PEY - PAPS1_HUMAN -
42 PsiBlast_CBE 82.3551%-120 - C2 -2AX4 - PAPS2_HUMAN -
25 PsiBlast_CBE 82.3250%-106 - C2 -1M7H 6.9 KAPS_PENCH
21 PsiBlast_CBE 82.2053%-112 - C2 -4FXP 8.2 APK1_ARATH
33 PsiBlast_CBE 82.0848%-111 - C2 -2OFW - PAPS1_HUMAN -
22 PsiBlast_CBE 82.0353%-113 - C2 -4FXP 8.7 APK1_ARATH
2 PsiBlast_PDB 81.9053%-111 - C2 -4FXP 8.3 APK1_ARATH
81 HHSearch 81.7754%-110 - C2 -3UIE 6.7 APK1_ARATH
7 PsiBlast_PDB 81.6647%-122 - C2 -1X6V 7.4 PAPS1_HUMAN
76 HHSearch 81.3853%-116 * C2 *2PEZ 7.6 PAPS1_HUMAN
1 PsiBlast_PDB 81.3653%-110 - C2 -3UIE 6.7 APK1_ARATH
4 PsiBlast_PDB 80.9750%-104 - C2 -1M7G 7.3 KAPS_PENCH
23 PsiBlast_CBE 80.9053%-115 - C2 -3UIE 6.9 APK1_ARATH
6 PsiBlast_PDB 80.7848%-108 - C2 -2OFX 9.1 PAPS1_HUMAN
75 HHSearch 80.6950%-115 - C2 -1X6V 7.4 PAPS1_HUMAN
43 PsiBlast_CBE 80.1651%-115 - C2 -3CR7 6.3 KAPS_PENCH
74 HHSearch 79.3952% -96 - C2 -1M7G 7.3 KAPS_PENCH
9 PsiBlast_PDB 79.3747%-108 - C2 -1XNJ 9.9 PAPS1_HUMAN
3 PsiBlast_PDB 77.9850%-122 - C2 -1D6J 3.6 KAPS_PENCH
26 PsiBlast_CBE 77.8950%-114 - C2 -1M7G 8.4 KAPS_PENCH
79 HHSearch 76.3453%-111 - C2 -4BZP 6.9 ?
15 PsiBlast_PDB 75.9853%-115 - C2 -4BZP 6.9 ?
44 PsiBlast_CBE 75.3253%-113 - C2 -4BZP 6.2 ?
17 PsiBlast_PDB 75.0053%-108 - C2 -4BZX 7.9 CYSNC_MYCTU
16 PsiBlast_PDB 74.7353%-106 - C2 -4BZQ 8.7 CYSNC_MYCTU
45 PsiBlast_CBE 74.0753%-107 - C2 -4BZX 8.0
46 PsiBlast_CBE 73.5953%-108 - C2 -4BZQ 3.7
78 HHSearch 72.3144%-110 - C2 -5CB8 8.4 CYSC_SYNY3
19 PsiBlast_PDB 69.7344%-104 - C2 -5CB8 8.4 CYSC_SYNY3
52 PsiBlast_CBE 68.7544%-103 - C2 -5CB6 8.0 CYSC_SYNY3
51 PsiBlast_CBE 68.3644%-103 - C2 -5CB6 3.7 CYSC_SYNY3
48 PsiBlast_CBE 68.1344%-104 - C2 -5CB6 6.7 CYSC_SYNY3
49 PsiBlast_CBE 67.5944%-102 - C2 -5CB6 3.4 CYSC_SYNY3
47 PsiBlast_CBE 67.4744%-101 - C2 -5CB8 8.5 CYSC_SYNY3
50 PsiBlast_CBE 67.4544%-101 - C2 -5CB6 7.8 CYSC_SYNY3
18 PsiBlast_PDB 66.8544% -99 - C2 -5CB6 7.7 CYSC_SYNY3
66 Fugue 62.0543% -86 - C2 -1D6J 3.6 KAPS_PENCH