@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu11100: (2016-06-17 )
MGLGKKLSVAVAASFMSLSISLPGVQAAEGHQLKENQTNFLSKNAIAQSELSAPNDKAVKQFLKKNSNIFKGDPSKRLKLVESTTDALGYKHFRYAPVVNGVPIKDSQVIVHVDKSDNVYAVNGELHNQSAAKTDNSQKVSSEKALALAFKAIGKSPDAVSNGAAKNSNKAELKAIETKDGSYRLAYDVTIRYVEPEPANWEVLVDAETGSILKQQNKVEHAAATGSGTTLKGATVPLNISYEGGKYVLRDLSKPTGTQIITYDLQNRQSRLPGTLVSSTTKTFTSSSQRAAVDAHYNLGKVYDYFYSNFKRNSYDNKGSKIVSSVHYGTQYNNAAWTGDQMIYGDGDGSFFSPLSGSLDVTAHEMTHGVTQETANLIYENQPGALNESFSDVFGYFNDTEDWDIGEDITVSQPALRSLSNPTKYNQPDNYANYRNLPNTDEGDYGGVHTNSGIPNKAAYNTITKLGVSKSQQIYYRALTTYLTPSSTFKDAKAALIQSARDLYGSTDAAKVEAAWNAVGL

Atome Classification :

(40 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NX6_A_9(3QH5)
THER_BACTH
[Raw transfer]




M3S_A_7(3FCQ)
THER_BACTH
[Raw transfer]




LEU_A_2(2WI0)
THER_BACTH
[Raw transfer]




GOL_A_10(3MSF)
THER_BACTH
[Raw transfer]




ANL_A_7(3MS3)
THER_BACTH
[Raw transfer]




ILE_A_2(2WHZ)
THER_BACTH
[Raw transfer]




PGO_A_7(3N21)
THER_BACTH
[Raw transfer]




IPA_A_8(3TLI)
THER_BACTH
[Raw transfer]




B3R_A_2(3MSA)
THER_BACTH
[Raw transfer]




IPA_A_8(2TLI)
THER_BACTH
[Raw transfer]




IPA_A_8(7TLI)
THER_BACTH
[Raw transfer]




IPA_A_8(8TLI)
THER_BACTH
[Raw transfer]




IPA_A_8(6TLI)
THER_BACTH
[Raw transfer]




IPA_A_8(4TLI)
THER_BACTH
[Raw transfer]




IPA_A_8(5TLI)
THER_BACTH
[Raw transfer]




TYR_A_3(2WHZ)
THER_BACTH
[Raw transfer]




LYS_A_3(2TLX)
THER_BACTH
[Raw transfer]




LYS_E_3(8TLN)
THER_BACTH
[Raw transfer]




TRP_A_3(2WI0)
THER_BACTH
[Raw transfer]




BXA_A_7(3NN7)
THER_BACTH
[Raw transfer]




NMU_A_7(3MSN)
THER_BACTH
[Raw transfer]




IPA_A_15(8TLI)
THER_BACTH
[Raw transfer]




3PL_E_9(1Y3G)
THER_BACTH
[Raw transfer]




48 PsiBlast_CBE 88.3746% -47 - C9 -3QH1 - THER_BACTH -
13 PsiBlast_PDB 88.2646% -43 - C9 -3DNZ - THER_BACTH -
14 PsiBlast_PDB 88.1246% -46 - C9 -3DO0 - THER_BACTH -
43 PsiBlast_CBE 87.9046% -46 - C9 -3T74 - THER_BACTH -
26 PsiBlast_CBE 87.8946% -46 - C9 -4OI5 - THER_BACTH -
17 PsiBlast_PDB 87.8646% -46 - C9 -3FB0 - THER_BACTH -
84 PsiBlast_CBE 87.8345% -46 - C9 -3P7W - THER_BACTH -
36 PsiBlast_CBE 87.8346% -47 - C9 -4D91 - THER_BACTH -
15 PsiBlast_PDB 87.8246% -45 - C9 -3DO1 - THER_BACTH -
16 PsiBlast_PDB 87.8046% -44 - C9 -3DO2 - THER_BACTH -
30 PsiBlast_CBE 87.7946% -47 - C9 -4MZN - THER_BACTH -
28 PsiBlast_CBE 87.7346% -46 - C9 -4N5P - THER_BACTH -
34 PsiBlast_CBE 87.6546% -45 - C9 -4H57 - THER_BACTH -
60 PsiBlast_CBE 87.6346% -46 - C9 -3FV4 - THER_BACTH -
31 PsiBlast_CBE 87.5946% -47 - C9 -4MXJ - THER_BACTH -
27 PsiBlast_CBE 87.5546% -46 - C9 -4N66 - THER_BACTH -
86 PsiBlast_CBE 87.5345% -46 - C9 -3P7U - THER_BACTH -
39 PsiBlast_CBE 87.5346% -46 - C9 -3T8F - THER_BACTH -
79 PsiBlast_CBE 87.5145% -49 - C9 -3TMN - THER_BACTH -
59 PsiBlast_CBE 87.4846% -45 - C9 -3FVP - THER_BACTH -
51 PsiBlast_CBE 87.2846% -45 - C9 -3N21 2.5 THER_BACTH
55 PsiBlast_CBE 87.2746% -47 - C9 -3MS3 2.8 THER_BACTH
98 PsiBlast_CBE 87.0945% -44 - C9 -2TLX 2.5 THER_BACTH
62 PsiBlast_CBE 87.0346% -46 - C9 -2WHZ 3.2 THER_BACTH
93 PsiBlast_CBE 86.9845% -43 - C9 -3FCQ 3.1 THER_BACTH
53 PsiBlast_CBE 86.9846% -44 - C9 -3MSF 2.1 THER_BACTH
72 PsiBlast_CBE 86.9545% -45 - C9 -5TLI 2.7 THER_BACTH
52 PsiBlast_CBE 86.9246% -43 - C9 -3MSN 3.6 THER_BACTH
65 PsiBlast_CBE 86.9145% -45 - C9 -8TLI 3.6 THER_BACTH
77 PsiBlast_CBE 86.7445% -46 - C9 -4TLI 2.6 THER_BACTH
54 PsiBlast_CBE 86.6446% -45 - C9 -3MSA 3.2 THER_BACTH
8 PsiBlast_PDB 86.5546% -45 - C9 -1Y3G 6.6 THER_BACTH
47 PsiBlast_CBE 86.5446% -45 - C9 -3QH5 3.2 THER_BACTH
64 PsiBlast_CBE 86.5245% -43 - C9 -8TLN 2.8 THER_BACTH
61 PsiBlast_CBE 86.5246% -44 - C9 -2WI0 3.2 THER_BACTH
80 PsiBlast_CBE 86.4345% -43 - C9 -3TLI 2.7 THER_BACTH
50 PsiBlast_CBE 86.2946% -44 - C9 -3NN7 2.2 THER_BACTH
99 PsiBlast_CBE 86.1745% -46 - C9 -2TLI 2.6 THER_BACTH
67 PsiBlast_CBE 85.9645% -42 - C9 -7TLI 2.7 THER_BACTH
69 PsiBlast_CBE 85.4445% -42 - C9 -6TLI 2.7 THER_BACTH