@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu11190: (2016-06-17 )
MKIGIVGATGYGGTELVRILSHHPHAEECILYSSSGEGNVYSEGYPHLTGLADQQLKPIDMNTIKHEIDIMFLAAPPGVSSELTPKLADAGITVIDLSGDLRIKEPAEYEKWYKRTAAPKAVIQEAVYGLAELNQLQIQQAKLIANPGCFPTAVLLGLAPLAQKKLLDESFVIVDAKTGVSGAGRKASMGTHFSELNDNFKIYKVNEHQHTPEIEQALNEWQPGLGPITFSAHLVPMTRGIMATMYTRLTCDLTADDLHDLYSEFYQDSYFVRVRPKGQYPQTKEVYGSNFCDIAVTLDERTNRVTIVSVIDNLMKGAAGQAVQNFNLMNGWNEETGLTITPIYP

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAP_A_3(2I3G)
ARGC_MYCTU
[Raw transfer]




NAP_B_4(2I3G)
ARGC_MYCTU
[Raw transfer]




NAP_A_4(5EIN)
?
[Raw transfer]




NAP_B_17(5EIN)
?
[Raw transfer]




NAP_B_7(5EIO)
?
[Raw transfer]




NAP_A_4(5EIO)
?
[Raw transfer]




FMT_A_9(5EIN)
?
[Raw transfer]




FMT_A_9(5EIN)
?
[Raw transfer]




8 PsiBlast_PDB 83.0234%-114 - C4 -2I3G 7.4 ARGC_MYCTU
21 PsiBlast_CBE 82.3634%-112 - C4 -2I3G 8.5 ARGC_MYCTU
23 PsiBlast_CBE 82.3034%-113 - C4 -2I3A - ARGC_MYCTU -
24 PsiBlast_CBE 81.8134%-111 - C4 -2I3A - ARGC_MYCTU -
22 PsiBlast_CBE 81.7134%-110 - C4 -2I3A - ARGC_MYCTU -
3 PsiBlast_PDB 81.4139%-101 - C4 -2Q49 - ARGC_ARATH -
7 PsiBlast_PDB 80.1334%-111 - C4 -2I3A - ARGC_MYCTU -
1 PsiBlast_PDB 79.9942% -92 - C4 -1VKN - ARGC_THEMA -
2 PsiBlast_PDB 79.8039%-104 - C4 -1XYG - ARGC_ARATH -
5 PsiBlast_PDB 79.6538%-118 - C4 -2G17 - ARGC_SALTY -
39 HHSearch 79.4639%-102 - C4 -1XYG - ARGC_ARATH -
38 HHSearch 79.1343% -94 - C4 -1VKN - ARGC_THEMA -
43 HHSearch 79.1038%-116 - C4 -3DR3 - ARGC_SHIFL -
6 PsiBlast_PDB 79.0337%-120 - C4 -3DR3 - ARGC_SHIFL -
4 PsiBlast_PDB 77.6037%-107 - C4 -2CVO - ARGC_ORYSJ -
10 PsiBlast_PDB 75.6932%-109 - C4 -5EIO 9.1 ?
9 PsiBlast_PDB 75.6934%-108 - C- -2NQT - ARGC_MYCTU -
25 PsiBlast_CBE 75.3032%-109 - C4 -5EIO 9.3 ?
12 PsiBlast_PDB 75.0931%-109 - C4 -5EIN 9.4 ?
41 HHSearch 74.7736%-107 - C- -2NQT - ARGC_MYCTU -
40 HHSearch 73.6932%-106 - C4 -5EIN 2.8 ?
26 PsiBlast_CBE 72.5631%-107 - C4 -5EIN 9.0 ?