@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu11220: (2016-06-17 )
MSSLFQTYGRWDIDIKKAKGTYVEDQNGKTYLDFIQGIAVSNLGHCHEAVTEAVKKQLDSVWHVSNLFQNSLQEQAAQKLAAHSAGDLVFFCNSGAEANEGAIKLARKATGKTKIITFLQSFHGRTYAGMAATGQDKIKTGFGPMLGGFHYLPYNDPSAFKALGEEGDIAAVMLETVQGEGGVNPASAEFLSAVQSFCKEKQALLIIDEIQTGIGRTGKGFAYEHFGLSPDIITVAKGLGNGFPVGAVIGKKQLGEAFTPGSHGTTFGGNMLAMAAVNATLQIVFQPDFLQEAADKGAFLKEQLEAELKSPFVKQIRGKGLMLGIECDGPVADIIAELQTLGLLVLPAGPNVIRLLPPLTVTKDEIAEAVSKLKQAIAHHSAVNQ

Atome Classification :

(51 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

P00_B_19(4JEW)
ARGD_SALTY
[Raw transfer]




P00_B_26(4JEX)
ARGD_SALTY
[Raw transfer]




P00_B_18(4JEZ)
ARGD_SALTY
[Raw transfer]




PLP_A_3(2ORD)
ARGD_THEMA
[Raw transfer]




PLP_B_13(4JEY)
ARGD_SALTY
[Raw transfer]




PLP_B_5(4NOG)
?
[Raw transfer]




PLP_B_9(4JF1)
ARGD_SALTY
[Raw transfer]




PLP_A_3(4NOG)
?
[Raw transfer]




PLP_A_3(4JF1)
ARGD_SALTY
[Raw transfer]




PFM_A_5(2OAT)
OAT_HUMAN
[Raw transfer]




PFM_A_5(2OAT)
OAT_HUMAN
[Raw transfer]




PLP_A_3(4NOG)
?
[Raw transfer]




PFM_C_7(2OAT)
OAT_HUMAN
[Raw transfer]




PLP_A_3(4ZWM)
?
[Raw transfer]




PLP_B_4(2PB0)
ARGD_SALTY
[Raw transfer]




PLP_A_3(2EO5)
?
[Raw transfer]




PFM_B_6(2OAT)
OAT_HUMAN
[Raw transfer]




PLP_B_10(4ZWM)
?
[Raw transfer]




PLP_B_6(1OAT)
OAT_HUMAN
[Raw transfer]




PLP_C_7(1OAT)
OAT_HUMAN
[Raw transfer]




PLP_B_6(2BYJ)
OAT_HUMAN
[Raw transfer]




PLP_A_5(2BYL)
OAT_HUMAN
[Raw transfer]




PLP_B_7(4ZLV)
?
[Raw transfer]




PLP_A_3(4ZLV)
?
[Raw transfer]




PLP_A_5(2BYJ)
OAT_HUMAN
[Raw transfer]




PLP_C_7(2BYL)
OAT_HUMAN
[Raw transfer]




PLP_A_5(1OAT)
OAT_HUMAN
[Raw transfer]




PLP_B_6(2BYL)
OAT_HUMAN
[Raw transfer]




PLP_A_3(1VEF)
ARGD_THET8
[Raw transfer]




PLP_C_7(2BYJ)
OAT_HUMAN
[Raw transfer]




PLP_A_3(3DOD)
BIOK_BACSU
[Raw transfer]




PEG_B_14(5EQC)
?
[Raw transfer]




PEG_A_6(5EQC)
?
[Raw transfer]




EDO_A_7(4JEZ)
ARGD_SALTY
[Raw transfer]




EDO_A_5(2PB2)
ARGD_SALTY
[Raw transfer]




EDO_B_12(4JF1)
ARGD_SALTY
[Raw transfer]




EDO_A_4(4JEX)
ARGD_SALTY
[Raw transfer]




EDO_A_7(4JEY)
ARGD_SALTY
[Raw transfer]




109 HHSearch 86.5241%-106 - C1 -3NX3 - ARGD_CAMJE -
57 PsiBlast_CBE 85.1733%-108 - C1 -1OAT 3.0 OAT_HUMAN
112 HHSearch 83.2539% -98 - C1 -4ADB - ASTC_ECOLI -
19 PsiBlast_PDB 83.2541%-104 - C1 -3NX3 - ARGD_CAMJE -
2 PsiBlast_PDB 82.8443% -98 - C1 -2E54 - ARGD_THEMA -
54 PsiBlast_CBE 82.5933%-111 - C1 -2OAT 6.0 OAT_HUMAN
58 PsiBlast_CBE 82.5433%-109 - C1 -1OAT 3.0 OAT_HUMAN
59 PsiBlast_CBE 82.1633%-109 - C1 -1OAT 3.1 OAT_HUMAN
24 PsiBlast_CBE 81.8841%-104 - C1 -1VEF - ARGD_THET8 -
5 PsiBlast_PDB 81.8541%-105 - C1 -1WKG - ARGD_THET8 -
6 PsiBlast_PDB 81.6541%-102 - C1 -1WKH - ARGD_THET8 -
103 HHSearch 81.4743% -99 - C1 -4JF1 3.8 ARGD_SALTY
4 PsiBlast_PDB 81.4541%-104 - C1 -1VEF - ARGD_THET8 -
63 PsiBlast_CBE 80.8132%-111 - C1 -1GBN - OAT_HUMAN -
65 PsiBlast_CBE 80.7932%-110 - C1 -1GBN - OAT_HUMAN -
21 PsiBlast_CBE 80.6545%-101 - C1 -2EH6 - ARGD_AQUAE -
56 PsiBlast_CBE 80.2633%-108 - C1 -2OAT 6.8 OAT_HUMAN
64 PsiBlast_CBE 80.1532%-110 - C1 -1GBN - OAT_HUMAN -
60 PsiBlast_CBE 80.1232%-108 - C1 -2CAN - OAT_HUMAN -
61 PsiBlast_CBE 80.0432%-108 - C1 -2CAN - OAT_HUMAN -
70 PsiBlast_CBE 79.9334%-113 - C1 -2BYL 2.9 OAT_HUMAN
120 HHSearch 79.8843% -98 - C1 -2ORD 4.6 ARGD_THEMA
115 HHSearch 79.6541%-101 * C1 *1VEF 2.7 ARGD_THET8
55 PsiBlast_CBE 79.6033%-108 - C1 -2OAT 7.2 OAT_HUMAN
52 PsiBlast_CBE 78.7533%-106 - C1 -2BYJ 3.1 OAT_HUMAN
51 PsiBlast_CBE 78.7533%-105 - C1 -2BYJ 3.2 OAT_HUMAN
53 PsiBlast_CBE 78.6633%-107 - C1 -2BYJ 2.8 OAT_HUMAN
72 PsiBlast_CBE 78.3634%-108 - C1 -2BYL 2.7 OAT_HUMAN
27 PsiBlast_CBE 78.3641% -98 - C1 -4JEY 3.8 ARGD_SALTY
25 PsiBlast_CBE 78.3542% -97 - C1 -4JEW 4.6 ARGD_SALTY
71 PsiBlast_CBE 77.8334%-109 - C1 -2BYL 3.0 OAT_HUMAN
102 HHSearch 77.4933%-105 - C1 -2OAT 6.8 OAT_HUMAN
46 PsiBlast_CBE 76.7534%-103 - C1 -4ZWM 4.4 ?
13 PsiBlast_PDB 76.4741% -97 - C1 -4JF1 2.9 ARGD_SALTY
28 PsiBlast_CBE 75.7341% -95 - C1 -4JF1 3.7 ARGD_SALTY
30 PsiBlast_CBE 75.6341% -97 - C1 -2PB0 2.9 ARGD_SALTY
29 PsiBlast_CBE 75.4641% -97 - C1 -2PB2 2.8 ARGD_SALTY
42 PsiBlast_CBE 74.2134%-100 - C1 -5EQC 1.5 ?
45 PsiBlast_CBE 73.9134%-100 - C1 -4ZWM 4.0 ?
47 PsiBlast_CBE 73.5634%-101 - C1 -4ZLV 3.0 ?
41 PsiBlast_CBE 73.4634% -97 - C1 -5EQC 1.9 ?
9 PsiBlast_PDB 73.4143%-100 - C1 -4JEX 3.0 ARGD_SALTY
31 PsiBlast_CBE 72.7741% -97 - C1 -4JEZ 1.7 ARGD_SALTY
26 PsiBlast_CBE 72.7343% -99 - C1 -4JEX 5.0 ARGD_SALTY
14 PsiBlast_PDB 72.6441%-100 - C1 -4JEZ 2.7 ARGD_SALTY
104 HHSearch 72.4134% -99 - C1 -4NOG 4.9 ?
48 PsiBlast_CBE 71.4434% -99 - C1 -4ZLV 3.9 ?
118 HHSearch 71.0531%-110 - C1 -3DOD 2.3 BIOK_BACSU
49 PsiBlast_CBE 71.0134% -98 - C1 -4NOG 4.6 ?
50 PsiBlast_CBE 70.2734%-100 - C1 -4NOG 4.9 ?
73 PsiBlast_CBE 64.1536% -97 - C1 -2EO5 4.4 ?