@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu11330: (2016-06-17 )
MKAGILGVGRYIPEKVLTNHDLEKMVETSDEWIRTRTGIEERRIAADDVFSSHMAVAAAKNALEQAEVAAEDLDMILVATVTPDQSFPTVSCMIQEQLGAKKACAMDISAACAGFMYGVVTGKQFIESGTYKHVLVVGVEKLSSITDWEDRNTAVLFGDGAGAAVVGPVSDDRGILSFELGADGTGGQHLYLNEKRHTIMNGREVFKFAVRQMGESCVNVIEKAGLSKEDVDFLIPHQANIRIMEAARERLELPVEKMSKTVHKYGNTSAASIPISLVEELEAGKIKDGDVVVMVGFGGGLTWGAIAIRWGR

Atome Classification :

(37 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

DCC_B_4(1U6S)
FABH_MYCTU
[Raw transfer]




COA_C_3(1HND)
FABH_ECOLI
[Raw transfer]




DCC_A_3(1U6S)
FABH_MYCTU
[Raw transfer]




COA_A_5(2EFT)
FABH_ECOLI
[Raw transfer]




COA_A_5(2GYO)
FABH_ECOLI
[Raw transfer]




COA_C_3(1MZJ)
FABH_STRLI
[Raw transfer]




COA_A_3(1EBL)
FABH_ECOLI
[Raw transfer]




COA_C_3(1MZJ)
FABH_STRLI
[Raw transfer]




COA_D_4(1MZJ)
FABH_STRLI
[Raw transfer]




UDT_A_3(2QNX)
FABH_MYCTU
[Raw transfer]




B82_A_5(3IL5)
FABH_ENTFA
[Raw transfer]




B82_C_7(3IL5)
FABH_ENTFA
[Raw transfer]




GOL_I_9(1HZP)
FABH_MYCTU
[Raw transfer]




DAO_C_3(1HZP)
FABH_MYCTU
[Raw transfer]




MLC_E_5(1HNJ)
FABH_ECOLI
[Raw transfer]




B82_D_8(3IL5)
FABH_ENTFA
[Raw transfer]




MLC_E_5(1HNJ)
FABH_ECOLI
[Raw transfer]




B82_B_6(3IL5)
FABH_ENTFA
[Raw transfer]




VZZ_B_5(2QO1)
FABH_MYCTU
[Raw transfer]




UDT_B_5(2QNX)
FABH_MYCTU
[Raw transfer]




VZZ_A_3(2QO1)
FABH_MYCTU
[Raw transfer]




COA_A_3(2QX1)
FABH_MYCTU
[Raw transfer]




ACE_F_6(1MZJ)
FABH_STRLI
[Raw transfer]




ACE_E_5(1MZJ)
FABH_STRLI
[Raw transfer]




DFD_B_5(2QNZ)
FABH_MYCTU
[Raw transfer]




D1T_A_4(2QO1)
FABH_MYCTU
[Raw transfer]




77 HHSearch 87.6753%-118 - C2 -2EBD - FABH_AQUAE -
3 PsiBlast_PDB 87.3852%-117 - C2 -2EBD - FABH_AQUAE -
21 PsiBlast_CBE 87.3650%-116 - C2 -1UB7 - ? -
20 PsiBlast_PDB 85.3342%-122 - C2 -1EBL 2.2 FABH_ECOLI
88 Fugue 85.3153%-114 * C2 *1UB7 - ? -
22 PsiBlast_CBE 85.3050%-112 - C2 -1UB7 - ? -
12 PsiBlast_PDB 84.8444%-121 - C2 -2EFT 5.8 FABH_ECOLI
9 PsiBlast_PDB 84.5644%-122 - C2 -1HND 7.6 FABH_ECOLI
33 PsiBlast_CBE 84.5144%-120 - C2 -1HN9 - FABH_ECOLI -
8 PsiBlast_PDB 84.5044%-120 - C2 -1HN9 - FABH_ECOLI -
13 PsiBlast_PDB 84.3344%-119 - C2 -2GYO 6.5 FABH_ECOLI
23 PsiBlast_CBE 84.2650%-111 - C2 -1UB7 - ? -
31 PsiBlast_CBE 84.1944%-120 - C2 -2GYO - FABH_ECOLI -
4 PsiBlast_PDB 83.4050%-111 - C2 -1UB7 - ? -
32 PsiBlast_CBE 83.1944%-121 - C2 -2EFT - FABH_ECOLI -
10 PsiBlast_PDB 83.0844%-120 - C2 -1HNJ 7.3 FABH_ECOLI
61 HHSearch 82.1344%-118 - C2 -1HNJ 7.3 FABH_ECOLI
62 HHSearch 81.2051%-109 - C2 -1UB7 - ? -
16 PsiBlast_PDB 80.9043%-115 - C2 -3IL9 - FABH_ECOLI -
5 PsiBlast_PDB 80.6143%-122 - C2 -4WZU - FABH2_VIBCH -
43 PsiBlast_CBE 79.2637%-115 - C2 -2QO1 3.1 FABH_MYCTU
44 PsiBlast_CBE 78.8337%-116 - C2 -2QNZ 3.4 FABH_MYCTU
49 PsiBlast_CBE 78.7437%-116 - C2 -1HZP 3.6 FABH_MYCTU
47 PsiBlast_CBE 78.6137%-115 - C2 -2QNX 3.4 FABH_MYCTU
48 PsiBlast_CBE 78.1037%-114 - C2 -1HZP 2.2 FABH_MYCTU
41 PsiBlast_CBE 77.6437%-115 - C2 -2QX1 4.1 FABH_MYCTU
46 PsiBlast_CBE 76.1537%-111 - C2 -2QNX 2.7 FABH_MYCTU
42 PsiBlast_CBE 75.4937%-112 - C2 -2QO1 3.8 FABH_MYCTU
34 PsiBlast_CBE 75.4842%-116 - C2 -3IL5 5.8 FABH_ENTFA
39 PsiBlast_CBE 75.0538%-114 - C2 -1MZJ 3.8 FABH_STRLI
38 PsiBlast_CBE 75.0538%-116 - C2 -1MZJ 2.7 FABH_STRLI
37 PsiBlast_CBE 74.9142%-114 - C2 -3IL5 6.0 FABH_ENTFA
54 PsiBlast_CBE 74.8636%-111 - C2 -1U6S 5.7 FABH_MYCTU
55 PsiBlast_CBE 74.5336%-113 - C2 -1U6S 8.3 FABH_MYCTU
71 HHSearch 73.8638%-112 - C2 -1MZJ 3.8 FABH_STRLI
35 PsiBlast_CBE 72.3442%-109 - C2 -3IL5 4.8 FABH_ENTFA
36 PsiBlast_CBE 71.3842%-112 - C2 -3IL5 5.0 FABH_ENTFA