Study : bsu11470 (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C1_S1
Best Complexes choosen after comparative docking [pKd > 3] : 5 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C1_S1
Complex: ATP_A_6(4YMV) / Model_51(4YMV/A) = [3.9] Download909.516.61MTEKLLEIKHLKQHFVTPRGTVKAVDDLSFDIYKGETLGLVGESGCGKSTTGRSIIRLYEATDGEVLFNGENVHGRKSRKKLLEFNRKMQMIFQDPYASLNPRMTVADIIAEGLDIHKLAKTKKERMQRVHELLETVGLNKEHANRYPHEFSGGQRQRIGIARALAVDPEFIIADEPISALDVSIQAQVVNLMKELQKEKGLTYLFIAHDLSMVKYISDRIGVMYFGKLVELAPADELYENPLHPYTKSLLSAIPLPDPDYERNRVRQKYDPSVHQLKDGETMEFREVKPGHFVMCTEAEFKAFS
Complex: ATP_A_9(1XEF) / Model_98(1XEF/A) = [4.9] Download1228.91-5.00MTEKLLEIKHLKQHFVTPRGTVKAVDDLSFDIYKGETLGLVGESGCGKSTTGRSIIRLYEATDGEVLFNGENVHGRKSRKKLLEFNRKMQMIFQDPYASLNPRMTVADIIAEGLDIHKLAKTKKERMQRVHELLETVGLNKEHANRYPHEFSGGQRQRIGIARALAVDPEFIIADEPISALDVSIQAQVVNLMKELQKEKGLTYLFIAHDLSMVKYISDRIGVMYFGKLVELAPADELYENPLHPYTKSLLSAIPLPDPDYERNRVRQKYDPSVHQLKDGETMEFREVKPGHFVMCTEAEFKAFS
Complex: ATP_A_7(4YMU) / Model_53(4YMU/A) = [4.9] Download1175.267.89MTEKLLEIKHLKQHFVTPRGTVKAVDDLSFDIYKGETLGLVGESGCGKSTTGRSIIRLYEATDGEVLFNGENVHGRKSRKKLLEFNRKMQMIFQDPYASLNPRMTVADIIAEGLDIHKLAKTKKERMQRVHELLETVGLNKEHANRYPHEFSGGQRQRIGIARALAVDPEFIIADEPISALDVSIQAQVVNLMKELQKEKGLTYLFIAHDLSMVKYISDRIGVMYFGKLVELAPADELYENPLHPYTKSLLSAIPLPDPDYERNRVRQKYDPSVHQLKDGETMEFREVKPGHFVMCTEAEFKAFS
Complex: AGS_B_6(3C4J) / Model_37(3C4J/B) = [4.9] Download1364.8910.59MTEKLLEIKHLKQHFVTPRGTVKAVDDLSFDIYKGETLGLVGESGCGKSTTGRSIIRLYEATDGEVLFNGENVHGRKSRKKLLEFNRKMQMIFQDPYASLNPRMTVADIIAEGLDIHKLAKTKKERMQRVHELLETVGLNKEHANRYPHEFSGGQRQRIGIARALAVDPEFIIADEPISALDVSIQAQVVNLMKELQKEKGLTYLFIAHDLSMVKYISDRIGVMYFGKLVELAPADELYENPLHPYTKSLLSAIPLPDPDYERNRVRQKYDPSVHQLKDGETMEFREVKPGHFVMCTEAEFKAFS
Complex: ANP_A_2(4AYW) / Model_99(4AYW/A) = [5.0] Download1692.631.25MTEKLLEIKHLKQHFVTPRGTVKAVDDLSFDIYKGETLGLVGESGCGKSTTGRSIIRLYEATDGEVLFNGENVHGRKSRKKLLEFNRKMQMIFQDPYASLNPRMTVADIIAEGLDIHKLAKTKKERMQRVHELLETVGLNKEHANRYPHEFSGGQRQRIGIARALAVDPEFIIADEPISALDVSIQAQVVNLMKELQKEKGLTYLFIAHDLSMVKYISDRIGVMYFGKLVELAPADELYENPLHPYTKSLLSAIPLPDPDYERNRVRQKYDPSVHQLKDGETMEFREVKPGHFVMCTEAEFKAFS
Consensus
[pKd Mean = 4.72]
-1274
(s=256)
4
(s=5)
MTEKLLEIKHLKQHFVTPRGTVKAVDDLSFDIYKGETLGLVGESGCGKSTTGRSIIRLYEATDGEVLFNGENVHGRKSRKKLLEFNRKMQMIFQDPYASLNPRMTVADIIAEGLDIHKLAKTKKERMQRVHELLETVGLNKEHANRYPHEFSGGQRQRIGIARALAVDPEFIIADEPISALDVSIQAQVVNLMKELQKEKGLTYLFIAHDLSMVKYISDRIGVMYFGKLVELAPADELYENPLHPYTKSLLSAIPLPDPDYERNRVRQKYDPSVHQLKDGETMEFREVKPGHFVMCTEAEFKAFS