@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu11470: (2016-06-18 )
MTEKLLEIKHLKQHFVTPRGTVKAVDDLSFDIYKGETLGLVGESGCGKSTTGRSIIRLYEATDGEVLFNGENVHGRKSRKKLLEFNRKMQMIFQDPYASLNPRMTVADIIAEGLDIHKLAKTKKERMQRVHELLETVGLNKEHANRYPHEFSGGQRQRIGIARALAVDPEFIIADEPISALDVSIQAQVVNLMKELQKEKGLTYLFIAHDLSMVKYISDRIGVMYFGKLVELAPADELYENPLHPYTKSLLSAIPLPDPDYERNRVRQKYDPSVHQLKDGETMEFREVKPGHFVMCTEAEFKAFS

Atome Classification :

(45 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_F_6(2FGK)
HLYBP_ECOLX
[Raw transfer]




ATP_H_8(2FGK)

[Raw transfer]




ATP_E_5(2FGK)
HLYBP_ECOLX
[Raw transfer]




ATP_E_5(2FGJ)
HLYBP_ECOLX
[Raw transfer]




ATP_J_5(4YMU)
?
[Raw transfer]




ATP_G_7(2FGK)
HLYBP_ECOLX
[Raw transfer]




ATP_H_8(2FGJ)

[Raw transfer]




ATP_A_7(4YMU)
?
[Raw transfer]




ANP_J_5(3C41)
?
[Raw transfer]




ATP_A_6(4YMV)
?
[Raw transfer]




ATP_C_11(1XEF)
HLYBP_ECOLX
[Raw transfer]




AGS_B_6(3C4J)
?
[Raw transfer]




ATP_J_5(4YMV)
?
[Raw transfer]




ATP_B_10(1XEF)
HLYBP_ECOLX
[Raw transfer]




ATP_D_12(1XEF)

[Raw transfer]




ATP_F_6(2FGJ)
HLYBP_ECOLX
[Raw transfer]




128_A_2(2PMK)

[Raw transfer]




ADP_B_2(2FFA)

[Raw transfer]




ATP_A_9(1XEF)
HLYBP_ECOLX
[Raw transfer]




ATP_G_7(2FGJ)
HLYBP_ECOLX
[Raw transfer]




ANP_K_6(3C41)
?
[Raw transfer]




ADP_B_2(2FF7)

[Raw transfer]




ADP_B_2(2FFB)

[Raw transfer]




12D_A_2(3B5J)

[Raw transfer]




ANP_A_2(4AYW)
ABCBA_HUMAN
[Raw transfer]




AGS_A_4(3C4J)
?
[Raw transfer]




AT4_B_6(2OLK)
?
[Raw transfer]




AT4_D_8(2OLK)
?
[Raw transfer]




4 PsiBlast_PDB 90.6232%-139 - C1 -3TUZ - METN_ECOLI -
24 PsiBlast_CBE 90.1132%-139 - C1 -3TUI - METN_ECOLI -
3 PsiBlast_PDB 89.4832%-133 - C1 -3TUI - METN_ECOLI -
101 HHSearch 89.4332%-124 - C1 -4FWI - ? -
25 PsiBlast_CBE 89.3332%-127 - C1 -3TUI - METN_ECOLI -
22 PsiBlast_CBE 88.3232%-131 - C1 -3TUZ - METN_ECOLI -
21 PsiBlast_CBE 88.1432%-136 - C1 -3TUZ - METN_ECOLI -
23 PsiBlast_CBE 88.0932%-131 - C1 -3TUZ - METN_ECOLI -
26 PsiBlast_CBE 87.4432%-128 - C1 -3TUI - METN_ECOLI -
17 PsiBlast_PDB 85.2833%-137 - C1 -3TUJ - METN_ECOLI -
20 PsiBlast_PDB 84.8333%-129 - C1 -2OLJ - ? -
45 PsiBlast_CBE 84.4233%-124 - C1 -2OLK 5.8 ?
46 PsiBlast_CBE 84.2733%-125 - C1 -2OLK - ? -
38 PsiBlast_CBE 84.1533%-122 - C1 -3C4J 6.5 ?
48 PsiBlast_CBE 84.0533%-127 - C1 -2OLK - ? -
2 PsiBlast_PDB 84.0132%-132 - C1 -3DHW - METN_ECOLI -
104 HHSearch 83.9133%-138 - C1 -3TUI - METN_ECOLI -
47 PsiBlast_CBE 83.6433%-122 - C1 -2OLK 5.8 ?
123 Fugue 83.4229%-121 - C1 -3TUZ - METN_ECOLI -
41 PsiBlast_CBE 83.4033%-125 - C1 -2OUK - ? -
37 PsiBlast_CBE 83.3033%-126 - C1 -3C4J 4.9 ?
53 PsiBlast_CBE 79.5034%-127 - C1 -4YMU 4.9 ?
52 PsiBlast_CBE 78.8234%-123 - C1 -4YMU 5.2 ?
19 PsiBlast_PDB 78.5632%-113 - C1 -3C41 6.6 ?
50 PsiBlast_CBE 77.8134%-126 - C1 -4YMV 6.1 ?
36 PsiBlast_CBE 77.6432%-122 - C1 -3C41 5.9 ?
51 PsiBlast_CBE 77.2734%-122 - C1 -4YMV 3.9 ?
99 PsiBlast_CBE 59.3831%-120 - C1 -4AYW 5.0 ABCBA_HUMAN
96 PsiBlast_CBE 57.3334%-127 - C1 -1XEF 5.6 HLYBP_ECOLX
98 PsiBlast_CBE 56.8134%-117 - C1 -1XEF 4.9 HLYBP_ECOLX
83 PsiBlast_CBE 56.3235%-121 - C1 -2PMK 5.3
95 PsiBlast_CBE 55.5134%-113 - C1 -1XEF 5.7
93 PsiBlast_CBE 55.1234%-108 - C1 -2FGJ 5.6 HLYBP_ECOLX
92 PsiBlast_CBE 54.7434%-111 - C1 -2FGJ 5.8 HLYBP_ECOLX
90 PsiBlast_CBE 54.6134%-109 - C1 -2FGJ 5.4
94 PsiBlast_CBE 54.3234%-112 - C1 -2FFA 5.1
88 PsiBlast_CBE 54.3034%-113 - C1 -2FFB 5.1
89 PsiBlast_CBE 54.2534%-119 - C1 -3B5J 5.4
84 PsiBlast_CBE 54.2034%-108 - C1 -2FGK 6.0
81 PsiBlast_CBE 54.0234%-113 - C1 -2FF7 5.1
97 PsiBlast_CBE 54.0134%-112 - C1 -1XEF 6.0 HLYBP_ECOLX
86 PsiBlast_CBE 53.4034%-112 - C1 -2FGK 6.1 HLYBP_ECOLX
91 PsiBlast_CBE 52.8434%-111 - C1 -2FGJ 5.5 HLYBP_ECOLX
85 PsiBlast_CBE 52.5634%-107 - C1 -2FGK 5.3 HLYBP_ECOLX
87 PsiBlast_CBE 52.4634%-104 - C1 -2FGK 6.0 HLYBP_ECOLX