@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu11610: (2016-06-18 )
MKFAVSSKGDQVSDTLKSKIQAYLLDFDMELDENEPEIVISVGGDGTLLYAFHRYSDRLDKTAFVGVHTGHLGFYADWVPHEIEKLVLAIAKTPYHTVEYPLLEVIVTYHENEREERYLALNECTIKSIEGSLVADVEIKGQLFETFRGDGLCLSTPSGSTAYNKALGGAIIHPSIRAIQLAEMASINNRVFRTVGSPLLLPSHHDCMIKPRNEVDFQVTIDHLTLLHKDVKSIRCQVASEKVRFARFRPFPFWKRVQDSFIGKGE

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

A22_A_2(4DY6)
NADK1_LISMO
[Raw transfer]




NAP_A_2(2I2A)
NADK1_LISMO
[Raw transfer]




NAD_A_2(2I29)
NADK1_LISMO
[Raw transfer]




DTA_A_2(2I2C)
NADK1_LISMO
[Raw transfer]




DTA_A_2(2I2C)
NADK1_LISMO
[Raw transfer]




DTA_A_2(2Q5F)
NADK1_LISMO
[Raw transfer]




ZNB_A_3(3V8P)
NADK1_LISMO
[Raw transfer]




A2D_A_2(2I2D)
NADK1_LISMO
[Raw transfer]




NAD_A_3(2I2F)
NADK1_LISMO
[Raw transfer]




GOL_A_5(3V7W)
NADK1_LISMO
[Raw transfer]




GOL_A_5(3V7U)
NADK1_LISMO
[Raw transfer]




A3N_A_4(3V7Y)
NADK1_LISMO
[Raw transfer]




MTA_A_2(3V7U)
NADK1_LISMO
[Raw transfer]




AOC_A_3(3V80)
NADK1_LISMO
[Raw transfer]




ZAS_A_2(3V7W)
NADK1_LISMO
[Raw transfer]




Z8B_A_2(3V8M)
NADK1_LISMO
[Raw transfer]




5NB_A_2(3V8R)
NADK1_LISMO
[Raw transfer]




CC5_A_3(2I2B)
NADK1_LISMO
[Raw transfer]




MTA_A_3(3V7U)
NADK1_LISMO
[Raw transfer]




ZAS_A_3(3V7W)
NADK1_LISMO
[Raw transfer]




5CI_A_3(3V8N)
NADK1_LISMO
[Raw transfer]




5N5_A_2(3V8Q)
NADK1_LISMO
[Raw transfer]




5NB_A_3(3V8R)
NADK1_LISMO
[Raw transfer]




CC5_A_2(2I2B)
NADK1_LISMO
[Raw transfer]




Z8B_A_3(3V8M)
NADK1_LISMO
[Raw transfer]




12 PsiBlast_PDB 92.0059%-109 - C2 -3V8M 3.9 NADK1_LISMO
8 PsiBlast_PDB 91.6159%-109 - C2 -3V7U 4.0 NADK1_LISMO
14 PsiBlast_PDB 91.2959%-112 - C2 -3V8P 7.4 NADK1_LISMO
1 PsiBlast_PDB 91.1759%-116 - C2 -2I1W - NADK1_LISMO -
9 PsiBlast_PDB 91.1559%-109 - C2 -3V7W 4.2 NADK1_LISMO
3 PsiBlast_PDB 90.7359%-109 - C2 -2I2A 7.6 NADK1_LISMO
30 HHSearch 90.7259%-107 - C2 -2I2C 7.5 NADK1_LISMO
6 PsiBlast_PDB 90.6759%-117 - C2 -2I2D 5.7 NADK1_LISMO
21 PsiBlast_CBE 90.6259%-114 - C2 -2I1W - NADK1_LISMO -
13 PsiBlast_PDB 90.4259%-108 - C2 -3V8N 4.1 NADK1_LISMO
5 PsiBlast_PDB 90.4259%-110 - C2 -2I2C 7.5 NADK1_LISMO
15 PsiBlast_PDB 90.3659%-112 - C2 -2I2F 6.6 NADK1_LISMO
7 PsiBlast_PDB 90.2559%-113 - C2 -4DY6 8.5 NADK1_LISMO
4 PsiBlast_PDB 90.0359%-110 - C2 -2I2B 4.0 NADK1_LISMO
17 PsiBlast_PDB 89.8159%-108 - C2 -3V8Q 3.9 NADK1_LISMO
18 PsiBlast_PDB 89.7859%-107 - C2 -3V8R 4.4 NADK1_LISMO
16 PsiBlast_PDB 89.6359%-111 - C2 -2Q5F 7.3 NADK1_LISMO
2 PsiBlast_PDB 89.6359%-114 - C2 -2I29 6.8 NADK1_LISMO
23 PsiBlast_CBE 88.8159%-107 - C2 -2I1W - NADK1_LISMO -
22 PsiBlast_CBE 88.4359%-114 - C2 -2I1W - NADK1_LISMO -
11 PsiBlast_PDB 88.3859%-109 - C2 -3V80 4.5 NADK1_LISMO
10 PsiBlast_PDB 88.2459%-110 - C2 -3V7Y 3.3 NADK1_LISMO