@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu11660: (2016-06-18 )
MELHAITDDSKPVEELARIIITIQNEVDFIHIRERSKSAADILKLLDLIFEGGIDKRKLVMNGRVDIALFSTIHRVQLPSGSFSPKQIRARFPHLHIGRSVHSLEEAVQAEKEDADYVLFGHVFETDCKKGLEGRGVSLLSDIKQRISIPVIAIGGMTPDRLRDVKQAGADGIAVMSGIFSSAEPLEAARRYSRKLKEMRYEKAL

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

3NM_B_7(3QH2)
TENI_BACSU
[Raw transfer]




3NM_D_9(3QH2)
TENI_BACSU
[Raw transfer]




3NM_C_8(3QH2)
TENI_BACSU
[Raw transfer]




144_M_13(1YAD)
TENI_BACSU
[Raw transfer]




144_N_14(1YAD)
TENI_BACSU
[Raw transfer]




23 PsiBlast_CBE 88.25100%-154 - C1 -3QH2 4.1 TENI_BACSU
21 PsiBlast_CBE 85.12100%-141 - C1 -3QH2 3.7 TENI_BACSU
22 PsiBlast_CBE 84.89100%-140 - C1 -3QH2 4.0 TENI_BACSU
24 PsiBlast_CBE 84.71100%-149 - C1 -1YAD 2.4 TENI_BACSU
124 Fugue 83.3199%-141 - C1 -1YAD 2.6 TENI_BACSU
101 HHSearch 57.7525%-148 - C1 -3NL6 - ? -
106 HHSearch 56.7027%-118 - C1 -2TPS - THIE_BACSU -
104 HHSearch 54.9927%-135 - C1 -3O63 - THIE_MYCTU -
131 Fugue 54.2225%-162 - C1 -4QCC - DGOA_ECOLI -
105 HHSearch 54.1230%-124 * C1 *1XI3 - THIE_PYRFU -
127 Fugue 53.9826%-112 - C1 -2TPS - THIE_BACSU -
28 PsiBlast_CBE 53.6533%-138 - C2 -1G67 - THIE_BACSU -
3 PsiBlast_PDB 52.5534%-133 - C2 -3O15 - THIE_BACSU -
31 PsiBlast_CBE 52.2633%-135 - C2 -1G6C - THIE_BACSU -
7 PsiBlast_PDB 52.1633%-135 - C2 -1G4S - THIE_BACSU -
1 PsiBlast_PDB 52.1434%-139 - C2 -2TPS - THIE_BACSU -
29 PsiBlast_CBE 51.8333%-134 - C2 -1G4S - THIE_BACSU -
25 PsiBlast_CBE 51.7934%-135 - C2 -2TPS - THIE_BACSU -
12 PsiBlast_PDB 50.9927%-141 - C1 -3O63 - THIE_MYCTU -
10 PsiBlast_PDB 50.9233%-131 - C2 -1G69 - THIE_BACSU -