@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu11720: (2016-06-18 )
MNFSLEGRNIVVMGVANKRSIAWGIARSLHEAGARLIFTYAGERLEKSVHELAGTLDRNDSIILPCDVTNDAEIETCFASIKEQVGVIHGIAHCIAFANKEELVGEYLNTNRDGFLLAHNISSYSLTAVVKAARPMMTEGGSIVTLTYLGGELVMPNYNVMGVAKASLDASVKYLAADLGKENIRVNSISAGPIRTLSAKGISDFNSILKDIEERAPLRRTTTPEEVGDTAAFLFSDMSRGITGENLHVDSGFHITAR

Atome Classification :

(32 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAP_G_9(3GR6)
FABI_STAAR
[Raw transfer]




NDP_C_12(4CV0)
?
[Raw transfer]




NDP_D_15(4CV0)
?
[Raw transfer]




NAP_B_7(4ALL)
?
[Raw transfer]




NDP_B_8(4CV0)
?
[Raw transfer]




NAD_D_7(3OIF)
FABI_BACSU
[Raw transfer]




NAD_C_9(2QIO)
?
[Raw transfer]




NAD_D_11(2QIO)
?
[Raw transfer]




NAP_A_5(3GR6)
FABI_STAAR
[Raw transfer]




NDP_B_10(3OJF)
FABI_BACCR
[Raw transfer]




NAD_A_2(3OIG)
FABI_BACSU
[Raw transfer]




NDP_C_12(3OJF)
FABI_BACCR
[Raw transfer]




NDP_A_5(4CV0)
?
[Raw transfer]




NAD_A_5(3OIF)
FABI_BACSU
[Raw transfer]




NAD_A_5(2QIO)
?
[Raw transfer]




NDP_D_8(3OJF)
FABI_BACCR
[Raw transfer]




NDP_A_6(3OJF)
FABI_BACCR
[Raw transfer]




NAD_B_7(2QIO)
?
[Raw transfer]




NAP_C_9(4ALL)
?
[Raw transfer]




NAP_A_6(4ALL)
?
[Raw transfer]




NAP_D_12(4ALL)
?
[Raw transfer]




NAP_J_11(3GR6)
FABI_STAAR
[Raw transfer]




NAP_D_7(3GR6)
FABI_STAAR
[Raw transfer]




NAD_A_5(1DFI)
FABI_ECOLI
[Raw transfer]




IMJ_D_7(3OJF)
FABI_BACCR
[Raw transfer]




IMJ_A_5(3OJF)
FABI_BACCR
[Raw transfer]




21 PsiBlast_CBE 92.50100%-131 - C5 -3OIF 10.4 FABI_BACSU
1 PsiBlast_PDB 91.92100%-132 - C5 -3OIF 10.4 FABI_BACSU
2 PsiBlast_PDB 91.55100%-129 - C5 -3OIG 11.5 FABI_BACSU
25 PsiBlast_CBE 84.0473%-131 - C5 -3OJF 11.3 FABI_BACCR
3 PsiBlast_PDB 83.8973%-130 - C5 -2QIO 11.0 ?
22 PsiBlast_CBE 82.2273%-130 - C5 -2QIO 10.8 ?
23 PsiBlast_CBE 81.6873%-128 - C5 -2QIO 10.8 ?
5 PsiBlast_PDB 81.1973%-130 - C5 -3OJF 10.6 FABI_BACCR
26 PsiBlast_CBE 80.9373%-130 - C5 -3OJF 10.5 FABI_BACCR
24 PsiBlast_CBE 80.3873%-125 - C5 -2QIO 10.9 ?
4 PsiBlast_PDB 80.1973%-149 - C5 -3OJE - FABI_BACCR -
27 PsiBlast_CBE 79.7573%-128 - C5 -3OJF 11.1 FABI_BACCR
74 PsiBlast_CBE 75.3758%-118 - C5 -4CV1 - ? -
79 PsiBlast_CBE 75.2458%-120 - C5 -4CV1 - ? -
94 PsiBlast_CBE 75.1858%-122 - C5 -4BNN - ? -
78 PsiBlast_CBE 74.9458%-119 - C5 -4CV1 - ? -
80 PsiBlast_CBE 74.8758%-117 - C5 -4CV1 - ? -
12 PsiBlast_PDB 74.6758%-117 - C5 -4ALK - ? -
33 PsiBlast_CBE 74.3258%-117 - C5 -4ALL 9.5 ?
101 PsiBlast_CBE 74.2558%-115 - C5 -4BNN - ? -
85 PsiBlast_CBE 74.1558%-117 - C5 -4CV0 8.7 ?
82 PsiBlast_CBE 73.9558%-117 - C5 -4CV0 9.2 ?
28 PsiBlast_CBE 73.9458%-117 - C5 -3GR6 8.3 FABI_STAAR
31 PsiBlast_CBE 73.2358%-115 - C5 -4ALL 9.6 ?
84 PsiBlast_CBE 73.2258%-114 - C5 -4CV0 10.3 ?
32 PsiBlast_CBE 72.9058%-117 - C5 -4ALL 9.8 ?
29 PsiBlast_CBE 72.3758%-114 - C5 -3GR6 10.1 FABI_STAAR
30 PsiBlast_CBE 72.1658%-111 - C5 -3GR6 7.1 FABI_STAAR
9 PsiBlast_PDB 71.6858%-115 - C5 -4ALL 8.8 ?
8 PsiBlast_PDB 71.3858%-110 - C5 -3GR6 7.8 FABI_STAAR
83 PsiBlast_CBE 71.2158%-112 - C5 -4CV0 8.6 ?
104 Fugue 59.6447%-130 - C5 -1DFI 5.8 FABI_ECOLI