@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu11820: (2016-06-18 )
MKCARLNDRIIHLHTYSREHYQFLFEEGIKGHLFCSHCGKPVLLRLNIADPPEFIHRQPGDFPACEEACEPKPSKEGKKEDDQESGVIRLPKGKAIAADPSPAVTEWHRPRSIKPGTPFVPKTIEPDTSLFPSVGLNTDQLKAVTETEGPLLVLAGAGSGKTRVLTARAAHMIEHLGIPPENMLLVTFTTKAVAEMKERMANQYGLQPAKVRRIVTGTFHSLFYKILYHSNSAKWNGEHLLKMEWQREQYIKKALYEEGIDEKESPVDQALQQIGFWKNTYVPNERIPLKDEWEKQVYRLYEHYERQKKEHSQFDFDDMASACYELFIERPDLLEQYQSRFTYILIDEFQDINPVQYKIMQMLASPEQNLCCVGDDDQSIYAFRGSNPSFILDFQKDYPGAKTIYLTANYRSTHPIVSSADIVVKKNKNRYAKTLEAARDDIQVPVLFYPYDEEEEATMVVSDIKEKIQNGASPEDFAVLYRTNSGGRAIYERLHQSSIPYTADRGVQSFYSRRIVRQILAYLYASQNEDDTEAIKHLLPALFLKQSALNTLKALSITEDCTMIKALAKLPDLKPFQLDKIKKIVPFFASLRTMKPVEAITFAEGKMGFSEYLKKRGNEGNKLEKGSDDLRDIKVVAKKFKTIPDFLAHVDHMRAAEKNRTDEHGVQLMTIHRSKGLEFKTVYVLGTVDGSIPHDFSLETARKGDEAALEEERRLLYVAMTRAKQHLYLSCPANRRGKTANRSRFLYPLLQKARQPLHH

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NACID_D_2(2IS1)
UVRD_ECOLI
[Raw transfer]

-

NACID_C_1(2PJR)
?
[Raw transfer]

-

NACID_D_2(2PJR)
?
[Raw transfer]

-

5 PsiBlast_PDB 85.8032% -88 - C1 -2IS2 - UVRD_ECOLI -
4 PsiBlast_PDB 85.7632% -89 - C1 -2IS1 Error UVRD_ECOLI
39 HHSearch 84.1926% 0 - C- -3U4Q - ADDA_BACSU -
35 HHSearch 82.5134% -84 - C1 -1PJR - PCRA_GEOSE -
6 PsiBlast_PDB 82.2332% -78 - C1 -2IS6 - UVRD_ECOLI -
34 HHSearch 81.1931% -79 * C1 *4C2T - ? -
21 PsiBlast_CBE 80.2832% -89 - C1 -2IS1 - UVRD_ECOLI -
25 PsiBlast_CBE 80.0633% -79 - C1 -4C30 - ? -
36 HHSearch 79.8130% -84 - C1 -1UAA - REP_ECOLI -
23 PsiBlast_CBE 79.6833% -79 - C1 -4C30 - ? -
26 PsiBlast_CBE 79.5533% -73 - C1 -4C2U - ? -
8 PsiBlast_PDB 79.1833% -73 - C1 -4C2U - ? -
7 PsiBlast_PDB 79.1233% -72 - C1 -4C2T - ? -
1 PsiBlast_PDB 78.7033% -81 - C1 -3PJR - ? -
22 PsiBlast_CBE 78.6933% -73 - C1 -4C2T - ? -
38 HHSearch 77.9131% -77 - C1 -4C2U - ? -
3 PsiBlast_PDB 77.5333% -80 - C1 -1PJR - PCRA_GEOSE -
9 PsiBlast_PDB 77.3233% -75 - C1 -4C30 - ? -
2 PsiBlast_PDB 76.6733% -80 - C1 -1QHG - PCRA_GEOSE -
24 PsiBlast_CBE 76.3333% -66 - C1 -4C30 - ? -
27 PsiBlast_CBE 67.4237% -81 - C1 -2PJR 9.4 ?
10 PsiBlast_PDB 65.4637% -83 - C1 -2PJR 10.6 ?