@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu12370: (2016-06-19 )
MVTIKDIAKLANVSHTTVSRALNNSPYIKEHTKKKILELAEQLNYTPNVNAKSLAMQKSHTIGLFFTSITNGTSHSFFADTIKGVNQAISEDYNLYVRGIDDLKNYDSVTPMRYDGIILMSQSDIDNSFIYHIREKNIPLVVLNRDIDDRTITNILSNDKEGSQEAVEYFIQSGHQDIAIIEGIEGFKSSQQRKEGYLSALIQHHIPIKHEYSVKGQYDMESGFQAMERLLALPNPPTAVFCSNDDMAIGAMNAIFAKGLRVPDDISVIGFDDIGFSQYITPRLSTVKRPVEKISVLGAQKLLSLISEPETKAEKILENTEFMVRDSVRRLTT

Atome Classification :

(31 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NACID_M_1(1ZAY)
PURR_ECOLI
[Raw transfer]

-

NACID_B_1(1JH9)
PURR_ECOLI
[Raw transfer]

-

NACID_M_1(1QPZ)
PURR_ECOLI
[Raw transfer]

-

NACID_B_1(2PUA)
PURR_ECOLI
[Raw transfer]

-

NACID_M_1(1QP7)
PURR_ECOLI
[Raw transfer]

-

NACID_B_6(3OQO)
CCPA_BACSU
[Raw transfer]

-

NACID_B_1(1JFS)
PURR_ECOLI
[Raw transfer]

-

NACID_M_1(1QQB)
PURR_ECOLI
[Raw transfer]

-

NACID_M_1(1QPZ)
PURR_ECOLI
[Raw transfer]

-

NACID_B_1(2PUC)
PURR_ECOLI
[Raw transfer]

-

NACID_B_1(2PUD)
PURR_ECOLI
[Raw transfer]

-

NACID_M_1(1QP0)
PURR_ECOLI
[Raw transfer]

-

NACID_B_1(2PUG)
PURR_ECOLI
[Raw transfer]

-

NACID_B_1(2PUB)
PURR_ECOLI
[Raw transfer]

-

NACID_E_5(3OQN)
CCPA_BACSU
[Raw transfer]

-

NACID_M_1(1QQA)
PURR_ECOLI
[Raw transfer]

-

NACID_B_1(1BDH)
PURR_ECOLI
[Raw transfer]

-

NACID_B_1(2PUE)
PURR_ECOLI
[Raw transfer]

-

NACID_B_1(2PUF)
PURR_ECOLI
[Raw transfer]

-

NACID_E_5(3OQM)
CCPA_BACSU
[Raw transfer]

-

NACID_B_6(3OQO)
CCPA_BACSU
[Raw transfer]

-

NACID_E_5(3OQN)
CCPA_BACSU
[Raw transfer]

-

NACID_E_5(3OQM)
CCPA_BACSU
[Raw transfer]

-

24 PsiBlast_CBE 81.4632%-119 - C2 -1ZVV - CCPA_BACSU -
25 PsiBlast_CBE 80.8732%-120 - C2 -1ZVV - CCPA_BACSU -
23 PsiBlast_CBE 78.8932%-117 - C2 -1ZVV - CCPA_BACSU -
13 PsiBlast_PDB 76.8531%-106 - C2 -1QP0 4.5 PURR_ECOLI
10 PsiBlast_PDB 76.7831%-107 - C2 -1PNR - PURR_ECOLI -
82 HHSearch 76.6131%-106 - C2 -1QPZ 4.6 PURR_ECOLI
1 PsiBlast_PDB 76.5331%-101 - C2 -1JH9 3.4 PURR_ECOLI
21 PsiBlast_CBE 76.3131%-105 - C2 -1VPW - PURR_ECOLI -
14 PsiBlast_PDB 76.2831%-105 - C2 -1QP4 - PURR_ECOLI -
5 PsiBlast_PDB 76.1431%-103 - C2 -1QQB 5.4 PURR_ECOLI
12 PsiBlast_PDB 76.0631%-106 - C2 -1WET - PURR_ECOLI -
9 PsiBlast_PDB 76.0631%-103 - C2 -2PUD 4.4 PURR_ECOLI
8 PsiBlast_PDB 76.0031%-103 - C2 -2PUC 4.0 PURR_ECOLI
15 PsiBlast_PDB 75.9831%-104 - C2 -1QPZ 4.6 PURR_ECOLI
6 PsiBlast_PDB 75.9531%-101 - C2 -2PUA 4.3 PURR_ECOLI
7 PsiBlast_PDB 75.8231%-105 - C2 -2PUB 4.0 PURR_ECOLI
17 PsiBlast_PDB 75.4331%-104 - C2 -1JFT - PURR_ECOLI -
20 PsiBlast_PDB 75.2531%-104 - C2 -2PUG 4.5 PURR_ECOLI
16 PsiBlast_PDB 75.2131%-103 - C2 -1ZAY 4.3 PURR_ECOLI
22 PsiBlast_CBE 75.2031%-101 - C2 -1JFS 4.1 PURR_ECOLI
2 PsiBlast_PDB 75.1831%-105 - C2 -1BDH 4.2 PURR_ECOLI
4 PsiBlast_PDB 74.8731%-103 - C2 -1QQA 5.0 PURR_ECOLI
3 PsiBlast_PDB 74.4831%-104 - C2 -1QP7 5.0 PURR_ECOLI
18 PsiBlast_PDB 73.6431%-101 - C2 -2PUE 3.6 PURR_ECOLI
19 PsiBlast_PDB 72.8331%-100 - C2 -2PUF 3.3 PURR_ECOLI
29 PsiBlast_CBE 71.0731%-110 - C2 -3OQN 5.0 CCPA_BACSU
26 PsiBlast_CBE 70.9831%-106 - C2 -3OQO 7.2 CCPA_BACSU
27 PsiBlast_CBE 70.8031%-107 - C2 -3OQO 5.6 CCPA_BACSU
31 PsiBlast_CBE 70.4231%-104 - C2 -3OQM 6.3 CCPA_BACSU
28 PsiBlast_CBE 70.0531%-103 - C2 -3OQN 6.6 CCPA_BACSU
30 PsiBlast_CBE 69.9131%-106 - C2 -3OQM 5.0 CCPA_BACSU