@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu12950: (2016-06-20 )
MEKVLSVQNLHVSFTTYGGTVQAVRGVSFDLYKGETFAIVGESGCGKSVTSQSIMGLLPPYSAKVTDGRILFKNKDLCRLSDKEMRGIRGADISMIFQDPMTALNPTLTVGDQLGEALLRHKKMSKKAARKEVLSMLSLVGIPDPGERLKQYPHQFSGGMRQRIVIAMALICEPDILIADEPTTALDVTIQAQILELFKEIQRKTDVSVILITHDLGVVAQVADRVAVMYAGKMAEIGTRKDIFYQPQHPYTKGLLGSVPRLDLNGAELTPIDGTPPDLFSPPPGCPFAARCPNRMVVCDRVYPGQTIRSDSHTVNCWLQDQRAEHAVLSGDAKD

Atome Classification :

(23 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_B_3(4FWI)
?
[Raw transfer]




ATP_B_3(4FWI)
?
[Raw transfer]




ANP_J_5(3C41)
?
[Raw transfer]




ATP_A_7(4YMU)
?
[Raw transfer]




ATP_A_6(4YMV)
?
[Raw transfer]




59 HHSearch 91.7036%-129 - C1 -4FWI 5.8 ?
1 PsiBlast_PDB 90.8237%-129 - C1 -4FWI 5.8 ?
51 Fugue 77.9728%-139 - C1 -3TUZ - METN_ECOLI -
64 HHSearch 76.8833%-151 * C1 *3TUI - METN_ECOLI -
7 PsiBlast_PDB 76.6232%-150 - C1 -3TUI - METN_ECOLI -
27 PsiBlast_CBE 76.3132%-157 - C1 -3TUI - METN_ECOLI -
25 PsiBlast_CBE 75.9232%-150 - C1 -3TUZ - METN_ECOLI -
10 PsiBlast_PDB 75.0832%-159 - C1 -3TUJ - METN_ECOLI -
8 PsiBlast_PDB 74.7032%-157 - C1 -3TUZ - METN_ECOLI -
29 PsiBlast_CBE 74.6432%-148 - C1 -3TUI - METN_ECOLI -
52 Fugue 74.5523%-116 - C1 -1Z47 - ? -
28 PsiBlast_CBE 74.2732%-149 - C1 -3TUI - METN_ECOLI -
24 PsiBlast_CBE 74.2432%-156 - C1 -3TUZ - METN_ECOLI -
50 Fugue 72.8825%-121 - C1 -1OXS - ? -
58 Fugue 72.1327%-121 - C1 -3B60 - MSBA_SALTY -
12 PsiBlast_PDB 71.7230%-140 - C1 -2OLK - ? -
11 PsiBlast_PDB 71.4130%-140 - C1 -2OLJ - ? -
13 PsiBlast_PDB 71.3030%-135 - C1 -2OUK - ? -
26 PsiBlast_CBE 71.0932%-150 - C1 -3TUZ - METN_ECOLI -
5 PsiBlast_PDB 70.5631%-141 - C1 -1V43 - ? -
16 PsiBlast_PDB 68.1630%-128 - C1 -3C41 6.4 ?
32 PsiBlast_CBE 63.9132%-138 - C1 -4YMU 4.2 ?
31 PsiBlast_CBE 62.3832%-133 - C1 -4YMV 3.2 ?