@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu12980: (2016-06-20 )
MKIIRIETSRIAVPLTKPFKTALRTVYTAESVIVRITYDSGAVGWGEAPPTLVITGDSMDSIESAIHHVLKPALLGKSLAGYEAILHDIQHLLTGNMSAKAAVEMALYDGWAQMCGLPLYQMLGGYRDTLETDYTVSVNSPEEMAADAENYLKQGFQTLKIKVGKDDIATDIARIQEIRKRVGSAVKLRLDANQGWRPKEAVTAIRKMEDAGLGIELVEQPVHKDDLAGLKKVTDATDTPIMADESVFTPRQAFEVLQTRSADLINIKLMKAGGISGAEKINAMAEACGVECMVGSMIETKLGITAAAHFAASKRNITRFDFDAPLMLKTDVFNGGITYSGSTISMPGKPGLGIIGAALLKGEKEQ

Atome Classification :

(24 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GLU_A_4(3R1Z)
XEEP_FRAP2
[Raw transfer]




TAR_A_7(3R0U)
XEEP_FRAP2
[Raw transfer]




TAR_A_7(3R0U)
XEEP_FRAP2
[Raw transfer]




TAR_A_4(3R0K)
XEEP_FRAP2
[Raw transfer]




ALA_A_3(3R1Z)
XEEP_FRAP2
[Raw transfer]




29 PsiBlast_CBE 89.17100% -83 - C1 -1JPM - AEEP_BACSU -
1 PsiBlast_PDB 88.62100% -81 - C1 -1JPM - AEEP_BACSU -
28 PsiBlast_CBE 88.39100% -81 - C1 -1JPM - AEEP_BACSU -
30 PsiBlast_CBE 87.29100% -80 - C1 -1JPM - AEEP_BACSU -
21 PsiBlast_CBE 84.45100% -76 - C1 -1TKK - AEEP_BACSU -
2 PsiBlast_PDB 83.99100% -75 - C1 -1TKK - AEEP_BACSU -
27 PsiBlast_CBE 83.98100% -77 - C1 -1TKK - AEEP_BACSU -
25 PsiBlast_CBE 83.92100% -76 - C1 -1TKK - AEEP_BACSU -
26 PsiBlast_CBE 83.85100% -75 - C1 -1TKK - AEEP_BACSU -
22 PsiBlast_CBE 83.69100% -75 - C1 -1TKK - AEEP_BACSU -
23 PsiBlast_CBE 83.42100% -73 - C1 -1TKK - AEEP_BACSU -
24 PsiBlast_CBE 83.23100% -77 - C1 -1TKK - AEEP_BACSU -
116 HHSearch 74.9499% -75 - C1 -1TKK - AEEP_BACSU -
129 HHSearch 59.9338% -95 - C1 -3Q45 - AAEP_CYTH3 -
9 PsiBlast_PDB 59.3739% -92 - C1 -3Q4D - AAEP_CYTH3 -
72 PsiBlast_CBE 58.6839% -92 - C1 -3Q4D - AAEP_CYTH3 -
69 PsiBlast_CBE 58.6039% -91 - C1 -3Q4D - AAEP_CYTH3 -
66 PsiBlast_CBE 58.5939% -92 - C1 -3Q4D - AAEP_CYTH3 -
81 PsiBlast_CBE 58.4639% -94 - C1 -3Q45 - AAEP_CYTH3 -
73 PsiBlast_CBE 58.3539% -91 - C1 -3Q4D - AAEP_CYTH3 -
17 PsiBlast_PDB 50.5732% -96 - C1 -3R1Z 3.8 XEEP_FRAP2
14 PsiBlast_PDB 50.4232% -93 - C1 -3R0U 2.2 XEEP_FRAP2
118 HHSearch 49.9333% -90 - C1 -3R0U 2.2 XEEP_FRAP2
13 PsiBlast_PDB 47.1032% -95 - C1 -3R0K 2.4 XEEP_FRAP2