@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu13120: (2016-06-20 )
MLRHVFLFLSQNKTLTKFAKAYGTRLGARRFVAGDTIESAVKTVKRLNRSGLCATIDYLGEYAASEKEANQVAEECKKAIQAIAEHQLDSELSLKLTSIGLDLSEELALTHLRAILSVAKQYDVAVTIDMEDYSHYEQTLSIYRQCKQEFEKLGTVIQAYLYRAAEDIKKMRDLKPNLRLVKGAYKESAAVAFPDKRGTDLHFQSLIKLQLLSGNYTAVATHDDDIIKFTKQLVAEHRIPASQFEFQMLYGIRPERQKELAKEGYRMRVYVPYGTDWFSYFMRRIAERPANAAFVLKGILKK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FAD_A_3(4H6Q)
?
[Raw transfer]




FDA_A_3(4H6R)
?
[Raw transfer]




FDA_C_4(4H6R)
?
[Raw transfer]




FAD_C_6(4H6Q)
?
[Raw transfer]




FAD_D_4(2G37)
?
[Raw transfer]




FAD_C_3(2G37)
?
[Raw transfer]




LAC_C_3(1TJ0)
PUTA_ECOLI
[Raw transfer]




LAC_C_3(1TJ1)
PUTA_ECOLI
[Raw transfer]




2OP_A_3(4O8A)
PUTA_ECOLI
[Raw transfer]




HYP_A_3(3E2Q)
PUTA_ECOLI
[Raw transfer]




PRO_A_2(3E2S)
PUTA_ECOLI
[Raw transfer]




PRO_C_3(2FZN)
PUTA_ECOLI
[Raw transfer]




TFB_A_3(4JNZ)
PUTA_ECOLI
[Raw transfer]




TFB_C_3(1TIW)
PUTA_ECOLI
[Raw transfer]




3 PsiBlast_PDB 77.4449%-123 - C1 -2G37 11.9 ?
34 HHSearch 76.9345%-109 - C1 -4H6Q - ? -
23 PsiBlast_CBE 76.8449%-121 - C1 -2G37 11.7 ?
22 PsiBlast_CBE 76.3047%-112 - C1 -4H6Q 12.4 ?
1 PsiBlast_PDB 76.0847%-108 - C1 -4H6Q 12.4 ?
2 PsiBlast_PDB 75.5447%-107 - C1 -4H6R 12.5 ?
21 PsiBlast_CBE 75.0047%-105 - C1 -4H6R 12.4 ?
11 PsiBlast_PDB 70.8228%-117 - C1 -1TIW 3.7 PUTA_ECOLI
15 PsiBlast_PDB 70.0228%-115 - C1 -2FZM - PUTA_ECOLI -
14 PsiBlast_PDB 70.0128%-116 - C1 -2FZN 3.7 PUTA_ECOLI
13 PsiBlast_PDB 70.0028%-119 - C1 -1TJ1 3.4 PUTA_ECOLI
17 PsiBlast_PDB 69.7127%-117 - C1 -4JNZ 3.4 PUTA_ECOLI
18 PsiBlast_PDB 69.6327%-115 - C1 -3E2Q 3.5 PUTA_ECOLI
16 PsiBlast_PDB 69.5328%-117 - C1 -4O8A 3.5 PUTA_ECOLI
10 PsiBlast_PDB 69.5228%-118 - C1 -1TJ2 - PUTA_ECOLI -
19 PsiBlast_PDB 69.2427%-114 - C1 -3E2R - PUTA_ECOLI -
12 PsiBlast_PDB 69.1428%-119 - C1 -1TJ0 3.4 PUTA_ECOLI
20 PsiBlast_PDB 68.9927%-117 - C1 -3E2S 3.7 PUTA_ECOLI
8 PsiBlast_PDB 64.7427%-108 - C1 -4NME - ? -
7 PsiBlast_PDB 64.1527%-106 - C1 -4NMD - ? -