@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu13750: (2016-06-21 )
MTTRKESELEGVTLLGNQGTNYLFEYAPDVLESFPNKHVNRDYFVKFNCPEFTSLCPKTGQPDFATIYISYIPDEKMVESKSLKLYLFSFRNHGDFHEDCMNIIMNDLIELMDPRYIEVWGKFTPRGGISIDPYTNYGKPGTKYEKMAEYRMMNHDLYPETIDNR

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GD1_C_9(4F8B)
QUEF_BACSU
[Raw transfer]




GD1_B_6(4F8B)
QUEF_BACSU
[Raw transfer]




PQ0_D_13(4FGC)
QUEF_BACSU
[Raw transfer]




GD1_D_11(4F8B)
QUEF_BACSU
[Raw transfer]




PQ0_B_6(4FGC)
QUEF_BACSU
[Raw transfer]




GD1_E_14(4F8B)
QUEF_BACSU
[Raw transfer]




PQ0_E_16(4FGC)
QUEF_BACSU
[Raw transfer]




PQ0_C_10(4FGC)
QUEF_BACSU
[Raw transfer]




17 PsiBlast_CBE 90.53100%-115 - C3 -4F8B 4.9 QUEF_BACSU
15 PsiBlast_CBE 89.59100%-116 - C3 -4F8B 5.2 QUEF_BACSU
16 PsiBlast_CBE 89.40100%-115 - C3 -4F8B 5.0 QUEF_BACSU
19 PsiBlast_CBE 89.0199%-111 - C3 -4FGC 3.7 QUEF_BACSU
21 PsiBlast_CBE 88.7899%-113 - C3 -4FGC 5.4 QUEF_BACSU
14 PsiBlast_CBE 88.69100%-116 - C3 -4F8B 4.8 QUEF_BACSU
20 PsiBlast_CBE 88.6599%-119 - C3 -4FGC 5.3 QUEF_BACSU
18 PsiBlast_CBE 86.0399%-114 - C3 -4FGC 2.9 QUEF_BACSU
32 HHSearch 85.23100%-122 - C3 -4F8B - QUEF_BACSU -
1 PsiBlast_PDB 85.23100%-122 - C3 -4F8B - QUEF_BACSU -
2 PsiBlast_PDB 83.3299%-127 - C3 -4FGC - QUEF_BACSU -
35 HHSearch 53.2724%-194 - C3 -1WUR - ? -
34 HHSearch 51.7427%-118 - C3 -3UXJ - QUEF_VIBCH -
37 HHSearch 51.2717%-207 * C3 *4UQF - GCH1_LISMO -
33 HHSearch 49.4725%-157 - C3 -3UXJ - QUEF_VIBCH -
36 HHSearch 48.3017%-188 - C3 -1A8R - GCH1_ECOLI -
10 PsiBlast_PDB 45.1326%-184 - C3 -1WUR - ? -
9 PsiBlast_PDB 44.0226%-175 - C3 -1WUQ - ? -
8 PsiBlast_PDB 43.8526%-184 - C3 -1WM9 - ? -
4 PsiBlast_PDB 43.5436%-182 - C3 -3RJ4 - QUEF_VIBCH -