@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu13770: (2016-06-21 )
MGKFEGKIALVTGGTSGIGLATAQKFVNEGAYVYITGRRQNELDKAVNQIGKNVTGVQGDISKLEDLDKLYDIIKQEKGKLDILFANAGIGNFLPLGEITEEQVDRTFDINVKGTIFTVQKALSLFPDKVGSIIVTGSTAGSIGNPAFSVYGASKAALRALVRNWILDLKGTEIRVNVVSPGGILTPAYDELFGDALEEVLENSRNTVPAGKVGTPEEVANAVSFLASDESSYLTGVELFVDGGLAQV

Atome Classification :

(34 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAI_A_4(1ZJY)
?
[Raw transfer]




NAP_A_3(4RF2)
?
[Raw transfer]




NAD_A_4(1ZJZ)
?
[Raw transfer]




NAP_B_6(4RF2)
?
[Raw transfer]




NAI_A_4(1ZK0)
?
[Raw transfer]




NAD_A_3(1ZK1)
?
[Raw transfer]




NAP_A_3(1ZK4)
?
[Raw transfer]




GOL_C_18(3PK0)
?
[Raw transfer]




GOL_A_9(3PK0)
?
[Raw transfer]




GOL_B_14(3PK0)
?
[Raw transfer]




GOL_D_22(3PK0)
?
[Raw transfer]




EDO_C_9(4BMN)
?
[Raw transfer]




EDO_A_12(3RIH)
?
[Raw transfer]




EDO_C_26(3RIH)
?
[Raw transfer]




EDO_B_18(3RIH)
?
[Raw transfer]




MPD_A_21(4H15)
?
[Raw transfer]




EDO_B_7(4BMN)
?
[Raw transfer]




34 PsiBlast_CBE 84.8355%-101 - C1 -4I5E - ? -
33 PsiBlast_CBE 84.8255%-101 - C1 -4I5E - ? -
29 PsiBlast_CBE 84.1855%-100 - C1 -4I5E - ? -
30 PsiBlast_CBE 83.8255%-101 - C1 -4I5E - ? -
32 PsiBlast_CBE 83.6655%-102 - C1 -4I5E - ? -
21 PsiBlast_CBE 83.3654% -96 - C1 -4BMS - ? -
4 PsiBlast_PDB 82.7755%-100 - C1 -4I5E - ? -
31 PsiBlast_CBE 82.2655%-101 - C1 -4I5E - ? -
22 PsiBlast_CBE 81.3554% -96 - C1 -4BMS - ? -
35 PsiBlast_CBE 81.2155%-102 - C1 -4I5E - ? -
23 PsiBlast_CBE 80.9054% -96 - C1 -4BMS - ? -
24 PsiBlast_CBE 80.6954% -94 - C1 -4BMS - ? -
1 PsiBlast_PDB 78.6557% -95 - C1 -4FGS - ? -
25 PsiBlast_CBE 78.5654% -95 - C1 -4BMS - ? -
26 PsiBlast_CBE 75.7254%-101 - C1 -4BMN - ? -
28 PsiBlast_CBE 75.2954%-102 - C1 -4BMN 3.1 ?
27 PsiBlast_CBE 73.8954% -99 - C1 -4BMN 3.3 ?
2 PsiBlast_PDB 72.9754%-103 - C1 -4BMN - ? -
41 PsiBlast_CBE 71.2555% -98 - C1 -4I5D - ? -
36 PsiBlast_CBE 70.1755% -97 - C1 -4I5D - ? -
43 PsiBlast_CBE 60.6137%-103 - C1 -3PK0 2.7 ?
45 PsiBlast_CBE 60.4437%-100 - C1 -3PK0 2.8 ?
63 PsiBlast_CBE 59.7836%-108 - C1 -3RIH 2.5 ?
48 PsiBlast_CBE 59.4638% -81 - C1 -4RF2 10.5 ?
7 PsiBlast_PDB 59.2737%-100 - C1 -3PK0 2.7 ?
44 PsiBlast_CBE 59.1937%-101 - C1 -3PK0 2.8 ?
17 PsiBlast_PDB 58.5437% -79 - C1 -1ZJY 6.6 ?
20 PsiBlast_PDB 57.9237% -77 - C1 -1ZK1 7.5 ?
11 PsiBlast_PDB 57.3738% -80 - C1 -4RF2 10.5 ?
18 PsiBlast_PDB 57.1437% -79 - C1 -1ZJZ 5.5 ?
61 PsiBlast_CBE 57.0536%-109 - C1 -3RIH 3.5 ?
15 PsiBlast_PDB 56.7837% -80 - C1 -1ZK4 6.0 ?
19 PsiBlast_PDB 56.7537% -77 - C1 -1ZK0 6.9 ?
62 PsiBlast_CBE 54.4236%-108 - C1 -3RIH 3.6 ?