@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu13960: (2016-06-21 )
MKKTIGFIGLGVMGKSMASHILNDGHPVLVYTRTKEKAESILQKGAIWKDTVKDLSKEADVIITMVGYPSDVEEVYFGSNGIIENAKEGAYLIDMTTSKPSLAKKIAEAAKEKALFALDAPVSGGDIGAQNGTLAIMVGGEKEAFEACMPIFSLMGENIQYQGPAGSGQHTKMCNQIAIAAGMIGVAEAMAYAQKSGLEPENVLKSITTGAAGSWSLSNLAPRMLQGNFEPGFYVKHFIKDMGIALEEAELMGEEMPGLSLAKSLYDKLAAQGEENSGTQSIYKLWVK

Atome Classification :

(28 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NDP_J_10(1WP4)
?
[Raw transfer]




NDP_L_12(1WP4)
?
[Raw transfer]




NDP_A_6(2CVZ)
?
[Raw transfer]




NAP_A_2(3WS7)
?
[Raw transfer]




NDP_K_11(1WP4)
?
[Raw transfer]




6PG_A_3(2W8Z)
?
[Raw transfer]




6PG_B_7(2W8Z)
?
[Raw transfer]




TLA_A_3(1VPD)
?
[Raw transfer]




6PG_A_3(2W90)
?
[Raw transfer]




EPE_A_6(3OBB)
SERDH_PSEAE
[Raw transfer]




EPE_A_6(3OBB)
SERDH_PSEAE
[Raw transfer]




47 HHSearch 85.1340%-131 - C1 -3WS7 12.2 ?
2 PsiBlast_PDB 84.0141%-140 - C1 -3W6Z - ? -
1 PsiBlast_PDB 83.3641%-138 - C1 -3WS7 - ? -
41 HHSearch 81.2337%-109 - C1 -1VPD 3.4 ?
4 PsiBlast_PDB 79.3834%-108 - C1 -1VPD - ? -
40 HHSearch 77.0237%-122 - C1 -3OBB 2.6 SERDH_PSEAE
21 PsiBlast_CBE 76.3532%-120 - C1 -2I9P - 3HIDH_HUMAN -
22 PsiBlast_CBE 76.2332%-117 - C1 -2I9P - 3HIDH_HUMAN -
7 PsiBlast_PDB 75.8332%-119 - C1 -2I9P - 3HIDH_HUMAN -
23 PsiBlast_CBE 75.7832%-120 - C1 -2I9P - 3HIDH_HUMAN -
9 PsiBlast_PDB 74.6630%-108 - C1 -3PEF - ? -
38 HHSearch 74.5430%-107 - C1 -3PEF - ? -
42 HHSearch 73.7824%-132 - C1 -3G0O - ? -
5 PsiBlast_PDB 73.4835%-131 - C1 -1YB4 - ? -
3 PsiBlast_PDB 72.8238%-126 - C1 -3W6U - ? -
44 HHSearch 72.8127%-112 - C1 -2UYY - GLYR1_HUMAN -
10 PsiBlast_PDB 72.4627%-113 - C1 -2UYY - GLYR1_HUMAN -
53 HHSearch 72.4232%-106 * C1 *4DLL - ? -
43 HHSearch 72.1929%-100 - C1 -3DOJ - GLYR1_ARATH -
48 HHSearch 71.9633%-114 - C- -2GF2 - 3HIDH_HUMAN -
54 HHSearch 69.8031%-116 - C1 -2CVZ 7.1 ?
16 PsiBlast_PDB 66.1734%-130 - C1 -3OBB 2.5 SERDH_PSEAE
25 PsiBlast_CBE 63.5934%-113 - C1 -1WP4 11.9 ?
24 PsiBlast_CBE 63.2634%-119 - C1 -1WP4 9.9 ?
26 PsiBlast_CBE 62.9534%-109 - C1 -1WP4 11.7 ?
20 PsiBlast_PDB 45.3633% -93 - C1 -2W90 3.4 ?
29 PsiBlast_CBE 44.9233% -91 - C1 -2W8Z 2.8 ?
28 PsiBlast_CBE 44.7433% -94 - C1 -2W8Z 2.1 ?